CAZyme Information: PV07_01449-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_01449-t44_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
947	KN847040.1|CGC1	106616.46	6.4025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847040.1:4959147-4961990(-)

Full Sequence      

MTGLPASPHLAHNFPISSIEIAPPTFEQHYSGFGVQFSRPRISWRFSTTNARVYDWVQNA
YDLEIRPIGGQAGLYHVDSAESALVPWPARCAALKSREQREVRVRCYGTCRQDDGTASQE
ATEVSHWSDWIVVEAALLSSHDWSASMITIKDPILPNEDGSARPLIFRKRFFLPSDRKIK
KARFYATSHGVYYASLNNKAIGDECMAPGWQSYKKRLHYQVHDIGSLLFHGVENLLVVNV
GAGWFASALSWVCRRFVYGTELGIMAQLEVQFDGTDEPFTVCTDSSWSVTSSAILSSEIY
NGEVYDQQRAIDITQENAQLSQNPWHEARVSNTVVAPLTSPNGPPVRVTERLRPKSFSRS
PSGKTIIDFGQNIAGRLCIRRLLKPAGHKVTFRHAEVMENGELGTAPLRTAQAKDTVICA
GEILTDWCPKFTFHGFRYVEVTGWSEQDMEMPLTKDSLFAEVLHSDMRRTGWFSCSNDEV
NQFHQNTVWSLRGNFLSIPSECPSRDERLGWTGDLNLFAPTATFLYDACGILGDWLQDLY
ADQMDEHEGWKKGMVPLYVPNCLLGLGPEDDGWHHMPNGVWGDAAVMVPFQLYLMTGDKH
ILLRQYESMTQWLESGVRRGEDGLWDRYQWQFGDWLDPSAPPNDSGRGRTDGTFVADCFL
IESTRRMAFIAKHLQKLDDFVHFSTVHLQLLTAFRTKYVTPAGLLAPDTATANALAIAFE
LLPSPEKSHTASEEHTTAARLSRALRFDDFCISTGFVGTAFLLSSLTKTHQDTLAYQMLL
SRSIPSVLYPVRMGATTIWERWNSLKPDGHINEASMTSFNHHALGAVSSWLHECVGGIKA
DEPGWKTIVIEPCINRMLSYAEVTYESVYGRIECRWKLDGDTLSIDVEVPPNTHARIVLP
DARDRRAQGLEVNDCWVGSGRYHFKSEYKRADQPVKAILPPWGRSSF

Enzyme Prediction     

EC	3.2.1.40:1	3.2.1.40:8	3.1.1.73:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	359	899	2.5e-150	0.9940476190476191
CBM67	162	331	1.6e-18	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	4.39e-116	468	835	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	1.54e-47	178	350	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	1.37e-32	359	464	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	1.44e-22	837	909	1	73	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT00162.1|CBM67|GH78	0.0	16	947	5	931
UKZ91467.1|GH78	0.0	19	947	8	931
BCS18429.1|GH78	1.14e-305	16	941	1	890
CAK38995.1|GH78	1.01e-299	17	940	3	912
BCS09327.1|GH78	5.84e-296	19	940	5	911

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	1.60e-224	18	925	1	866	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	2.54e-124	168	924	306	1028	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	3.80e-104	134	927	136	942	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P9WF03|RHA78_ALTSL	2.06e-127	17	900	24	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
sp|Q82PP4|RHA78_STRAW	9.93e-124	168	924	306	1028	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KNB2|PLH20_FORAG	7.75e-122	123	900	129	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|T2KPL4|PLH28_FORAG	5.92e-65	120	922	123	945	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV07_01449-t44_1-p1.