CAZyme Information: PV07_01075-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_01075-t44_1-p1
• CAZy Family: GT91
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289	KN847040.1|CGC8	30999.08	3.8487

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847040.1:3714498-3715367(+)

Full Sequence      

MKTSQLLACVAAAVSGAEAYYKGFNIGANLANGACRSESDWEFVFNKIASFPGNFKNARL
YASSDCNTLANAVPAAIKTGTSLLVGIWTEDDSHYEAEKQALLEAIQQYGSDWILAVSVG
SEDLYRGDTDANTLASQINDVRGMLWGLGASSKSVGHVDTWTAWVDPANTAVIEAVDWLG
NDAYPYWQGVGIDNGAANDAYWAAVNQVRAVAGGRDVWTTETGWPISGDAVGSAVPSVDS
LQTYWWQVSCASFDSLNYFFYDVDDFAASPSFAVVDSNYDPLIDMTCGS

Enzyme Prediction     

No EC number prediction in PV07_01075-t44_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.51e-47	22	274	46	294	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	6.48e-20	23	251	2	266	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW94742.1|GH17	7.27e-107	19	286	18	286
APA06410.1|GH17	1.50e-105	1	287	1	295
CCD34315.1|GH17	1.36e-103	1	287	1	294
ATZ46547.1|GH17	1.36e-103	1	287	1	294
UJO17243.1|GH17	4.66e-103	1	285	1	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.16e-23	16	250	33	252	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	8.17e-23	16	250	33	252	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UUZ1|EGLC_ASPOR	3.64e-61	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	1.05e-59	7	289	6	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	1.15e-59	7	289	6	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	8.86e-59	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q5AUT0|EGLC_EMENI	1.88e-57	1	289	1	313	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000341	0.999633	CS pos: 19-20. Pr: 0.9298

TMHMM  Annotations     

There is no transmembrane helices in PV07_01075-t44_1-p1.