CAZyme Information: PV07_00341-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_00341-t44_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
597		64352.80	7.9577

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847040.1:1141571-1143488(+)

Full Sequence      

MKSKISLTSVCCFLLLGGTTQAAPQQYCKPVVGSPGWPSASDWHALNNSVSGRLIAPVPP
GLVCQTNSSVYNAQACGQVLAQWSNSSFHAEDPFTTDYNDDSCLPDPRAPCSTALLPAYV
VNATNTADVQAACRFAYKTGVRLIVKGTGHDFLGRSSGRSSLSIWTHNIRGVNVTMGDSR
AKRYGGVASVKIAAGMRFGEIYQAISSYNLTLVGGADPNVGIGGWVTGAGHSPISAVYGL
GADQVLEMDVVTANGTHLTINEDSFPGLFWAMRGGGGSTFAVLLSVTVRAYPVLPAAVYT
FSYNTTANSDTFWSLVAYFHNQLPELSDAGIMGYYFITPNNSASQSDPARMGSVSGFWFA
PNKSVEETQHILAPMEQTIQKNAYNWTDAIFVSNVSAPVPDFTKFWLAFVTPQSVGSEVR
LGSRLFDRAALKTDPAKLKRLFKQTSPIPQYPILGHVVAGKGVKTVKNGIPGGSNSVLPA
WRKAYAHIVLPRSWAFLNETAKIAATTQLREVETEALRELAPNMGAYVNEADPTEPNWQE
TFWGSNYPRLLQLKRYWDPKSVFWCVPCVGHTDGWEVVGQAGVEGAVGESSGRICRT

Enzyme Prediction     

No EC number prediction in PV07_00341-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	116	563	9.6e-52	0.9563318777292577

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.49e-21	117	261	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	5.46e-19	116	563	31	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	2.21e-14	526	564	1	39	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215258	PLN02465	8.40e-05	190	292	161	262	L-galactono-1,4-lactone dehydrogenase
130737	GLDHase	1.40e-04	189	405	125	326	galactonolactone dehydrogenase. This model represents L-Galactono-gamma-lactone dehydrogenase (EC 1.3.2.3). This enzyme catalyzes the final step in ascorbic acid biosynthesis in higher plants. This protein is homologous to ascorbic acid biosynthesis enzymes of other species: L-gulono-gamma-lactone oxidase in rat and L-galactono-gamma-lactone oxidase in yeast. All three covalently bind the cofactor FAD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.84e-58	16	576	488	1055
QKD57322.1|CBM91|GH43_11	1.84e-58	16	576	488	1055
QRW27390.1|AA7	2.85e-20	117	563	66	484
CCD53507.1|AA7|CBM18	6.28e-20	117	573	77	522
ATZ50223.1|AA7|CBM18	6.28e-20	117	573	77	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	8.98e-89	13	596	8	573	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	1.36e-69	13	573	10	586	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6FYD_A	4.65e-20	117	563	45	453	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6JQH_A	8.31e-20	84	289	15	220	Chain A, MaDA [Morus alba],6JQH_B Chain B, MaDA [Morus alba]
6FYB_A	1.11e-19	117	563	45	453	The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_B The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_C The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_D The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYC_A The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus],6FYC_B The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AS41|A7056_ARTBC	1.61e-98	1	579	1	584	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07056 PE=1 SV=2
sp|A0A0E0RTV6|ZEB1_GIBZE	1.33e-88	14	597	11	563	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|G2QDQ9|VAO15_MYCTT	4.62e-88	13	596	8	573	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1
sp|A1CFM2|PATO_ASPCL	6.36e-82	24	596	25	567	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|A0A1V6PBT1|CALF_PENDC	1.34e-81	15	596	12	574	Bifunctional decalin synthase calF OS=Penicillium decumbens OX=69771 GN=calF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999786	CS pos: 22-23. Pr: 0.9793

TMHMM  Annotations     

There is no transmembrane helices in PV07_00341-t44_1-p1.