CAZyme Information: PV06_11281-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_11281-t43_1-p1
• CAZy Family: GT50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859	KN847356.1|CGC1	94117.02	5.1796

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847356.1:15235-17930(-)

Full Sequence      

MVACDVGYLLSQLSLQEKVSLLAGADGWQTQEVARLGIGSLKTTDGPCGARGKSTVDGPT
SALLPAPVAQAATWSTKAVRAIGRLLCEEAKTKAAHVLLAPTICCARNPLGGRNFESFSE
DPLLSGKLAVEYISGLQESGEVGATVKHFVANEQEEGRFIINVNASERTLREIYLRPFEM
TVKSANPPTCVMTAYNCVNGLHMDMNRKLLTETLRNEWGFDGVVMSDWGGTNSMAESLLA
GLDLEMPGPAAHRGANLLAHLQKAPDEEILKAIDASCSRVLRLLRGKNLLGLSATEVVES
RNRTETSSYTDLDQQLLRSVAADGIVLLKNSKEMLPLTPDKIHGKRVAFIGPNSFHGTPS
GGGSSNLNQHYQTHPMEAFKAITASLDIKVDVEHSPGAFSYKYLPLASNEQWHSPRRLPG
MQQKHMLRLDFFASTDFSGPILETQYRNSSNIDLSDTAPAGLSEKGDPYSFRLSTTVTPK
SSGMHDFGIASVGNARLYVNNDLLIDNYDWFGPAETFYCFGSAEKRGKLYMTAGRSYEVR
IDSSSKLSVKPDSNQSDANYVYGIQPSVRFGFLEQLPENPIADALALAQRSDITILVLGL
NEDWEGEGHDRTTMSLPGKQDALVQTLLRSVSHPENVVIVNQSGSPVEMDWETEASTIVQ
AWYGGQEAGNALCDVLIGRVNPSGRLPISWPFKYSDMDFQRFKHTWPGVDGQVDYAEETL
VGYRWYLHEGVKPRYWFGYGLGYSTFNISNLETSETTSGWDLTAEVSNTGKTAGQEVVQL
YSSLLGGAGVRELRSFEKTGTLAAGEMRTVTLGLEKRGLAHWDGRWITEKGVYLLEVGRN
AGDENMLMAEVSVDERLEW

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	247	7.3e-63	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	6.97e-61	28	388	50	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	2.00e-52	65	838	121	751	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	6.04e-46	554	743	54	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	7.82e-40	9	838	56	769	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.12e-37	29	283	57	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPX44937.1|GH3	4.76e-315	5	854	5	859
UPK95903.1|GH3	2.06e-313	5	859	8	862
CEI68113.1|GH3	9.43e-307	9	845	10	854
EGX47427.1|GH3	2.45e-191	9	830	14	826
EGX50909.1|GH3	7.53e-190	9	843	23	828

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.58e-164	5	859	5	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.46e-159	5	859	5	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.15e-97	3	843	2	659	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.49e-88	6	841	4	702	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.06e-87	6	841	4	702	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	3.77e-170	9	843	14	829	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P07337|BGLS_KLUMA	8.82e-161	5	859	5	842	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	3.07e-160	6	859	14	862	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	4.32e-160	6	859	14	862	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|A1DNN8|BGLJ_NEOFI	2.32e-159	6	859	14	861	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000009

TMHMM  Annotations     

There is no transmembrane helices in PV06_11281-t43_1-p1.