CAZyme Information: PV06_11153-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_11153-t43_1-p1
• CAZy Family: GT41|GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841	KN847351.1|CGC1	91535.49	4.2986

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847351.1:78902-82806(+)

Full Sequence      

MQQLGIICILSLVLLSHAKLYLASSRRYDPIRRFVSTIGGPHAGYFVNNTYESNIGLSVA
TQELELGAQQKSKVVVNNIANSSEVNMYVTGNDLTNNLVILTPNGQWYYPTVNGSLNVPM
KLSSDVITIPVQCTSPAIEVRLPSPVSAGRIWFAHGDLEFSVVRTQASSASLVQPSLTYA
NTSWGFVEFTTTPEEGLWVNLSFVDFVGIALGLELVGFSPENTTSVSQSALGLHSSAIDT
LCRRLADQSIIDGYSWGDLCLRNSDSRPVRVLSPTSYIQANPEAFSDYWTCYIEEVWTRY
TSESLIIYPHSQDLGNISCGVQDDLLICTDANGTVEDFGKPSAKDVFGCNSGPFTITENS
SDLSRAVVPRLCAGINRSTLLLGNSSFQPSGIPPSLYYTGNVTNWYSKLVHQLEIDGKGR
FVSTIGGPHAGYFVNNTYESNIGLSVATQELELGAQQKSKVVVNNIANSSEVNMYVTGND
LTNNLVILTPNGQWYYPTVNDSLNVPMKLSSDVITIPVQCTSPAIEVRLPSPVSAGRIWF
AHGDLEFSVVRTQASSASLVQPSLTYANTSWDFVEFTTTPEEGLWVNLSFVDFVGIALGL
ELVNYSPENTTSVPQSALGLQSSAIDTLCRRLADQSIIDGYSWGDLCLRNSDSRPVRVLS
PTSYIQANPEAFSDYWTCYIEEVWTRYTSESLIIYPHSQDLGNISCGVQDDLLICTDANG
TVEDFGKPSAKDVFGCNSGPFTITENSSDLSRAVVPRLCAGINRSTLLLGNSSFQPSGIP
PSLYYTGNVTNWYSKLVHQLEIDGKGYAFPYDDVSSVDGDDSQSGLLTAPEPWVLSLFVG
A

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH64	462	837	2.8e-80	0.9700272479564033
GH64	75	419	2.8e-68	0.9019073569482289

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185759	GH64-GluB-like	1.43e-112	462	840	5	369	glycoside hydrolase family 64: beta-1,3-glucanase B (GluB)-like. This subfamily is represented by GluB, beta-1,3-glucanase B , from Lysobacter enzymogenes Strain N4-7 and related bacterial and ascomycete proteins. GluB is a member of the glycoside hydrolase family 64 (GH64) involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. GluB possesses the conserved Glu and Asp residues required to cleave substrate beta-1,3-glucans. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Based on the structure of laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis, which belongs to the same family as GluB but to a different subfamily, this cd is a two-domain model. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain.
406796	Glyco_hydro_64	1.85e-107	462	839	7	370	Beta-1,3-glucanase. Family 64 glycoside hydrolases have beta-1,3-glucanase activity.
185759	GH64-GluB-like	1.77e-105	75	419	5	336	glycoside hydrolase family 64: beta-1,3-glucanase B (GluB)-like. This subfamily is represented by GluB, beta-1,3-glucanase B , from Lysobacter enzymogenes Strain N4-7 and related bacterial and ascomycete proteins. GluB is a member of the glycoside hydrolase family 64 (GH64) involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. GluB possesses the conserved Glu and Asp residues required to cleave substrate beta-1,3-glucans. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Based on the structure of laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis, which belongs to the same family as GluB but to a different subfamily, this cd is a two-domain model. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain.
406796	Glyco_hydro_64	5.92e-101	75	419	7	339	Beta-1,3-glucanase. Family 64 glycoside hydrolases have beta-1,3-glucanase activity.
185755	GH64-LPHase-like	4.74e-51	462	811	5	330	glycoside hydrolase family 64: laminaripentaose-producing, beta-1,3-glucanase (LPHase)-like. This subfamily is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. Also included in this family is GluB , the beta-1,3-glucanase B from Lysobacter enzymogenes Strain N4-7. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. In the Cellulosimicrobium cellulans, glucan endo-1,3-beta-glucosidase, they are positioned N-terminal of a RICIN, carbohydrate-binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP79867.1|GH64	2.27e-88	444	840	57	437
QDS73855.1|GH64	2.98e-88	459	840	156	530
QIW99422.1|GH64	1.43e-84	462	840	72	439
QGA12532.1|GH64	3.04e-84	462	840	69	442
QYS99657.1|GH64	8.02e-83	418	841	26	439

PDB Hits     

PV06_11153-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

PV06_11153-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999771	CS pos: 18-19. Pr: 0.8917

TMHMM  Annotations     

There is no transmembrane helices in PV06_11153-t43_1-p1.