CAZyme Information: PV06_11106-t43_4-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_11106-t43_4-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281		32065.97	7.7355

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847350.1:120525-121427(+)

Full Sequence      

MLTLAFRRLEVSNCEVKYEGRSVRVITCPIGIDPEEFHARLNLPKVQDRIKVLHKRYEDV
KLIVSVDRLDYVKGIPLRMEAMEALLTKHPEHIGKVVLLQVLIPSREAVQGYRHLHHQID
ESISRINGKFGLSLCKHPRSILLLTVFIGDIEYSPIQSQFCSVSKDELTALYAASDACII
SSTRDGFNVVSLEYIACQRDRLGVLLLSEFAGAAAVLDDSIKFNPWDTDKFSKAIHQAVT
MDEEEKRQRFNQLQSFVMRNTSQRWGQTFLDALQNTGRTHI

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	9	274	1.4e-90	0.5221052631578947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	8.66e-111	16	274	223	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	3.46e-101	12	275	223	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	1.39e-87	18	275	239	479	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
184712	PRK14501	2.07e-82	4	276	209	463	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215556	PLN03064	6.39e-66	16	276	319	562	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR91987.1|GT20	6.68e-80	16	273	235	474
EAL87495.1|GT20	1.44e-79	9	273	228	474
QRD88560.1|GT20	2.03e-79	9	270	228	471
QMW25465.1|GT20	2.03e-79	9	270	228	471
BAE56442.1|GT20	2.03e-79	9	270	228	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVO_A	4.97e-81	9	273	228	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	3.02e-79	16	273	223	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	3.50e-73	16	273	235	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	2.68e-70	16	273	228	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	1.05e-69	16	273	228	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WHW0|TPS1B_ASPFU	2.56e-80	9	273	228	474	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=tpsB PE=1 SV=1
sp|A0A384JAD8|TPS1_BOTFB	1.73e-78	16	274	236	476	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TPS1 PE=1 SV=1
sp|Q00217|TPS1B_ASPNG	6.47e-78	9	273	229	475	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Aspergillus niger OX=5061 GN=tpsB PE=2 SV=1
sp|O59921|TPS1_EMENI	3.51e-73	16	273	235	474	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=tpsA PE=3 SV=1
sp|Q00075|TPS1A_ASPNG	4.80e-73	16	273	236	475	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aspergillus niger OX=5061 GN=tpsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV06_11106-t43_4-p1.