CAZyme Information: PV06_10610-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_10610-t43_1-p1
• CAZy Family: GT35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513		54664.48	4.7631

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847345.1:250353-252013(-)

Full Sequence      

MRAVSISLLLPSLAVAASNASVGVMGTTGYPPCDALISAGLGDRVLLATSDAYETRVQSY
WHANGRIHPYCFVEPYSAEEVSTAVKALASAGQGAGDWHIAVRSGGHHLPATNNIVDGVT
IDLGMMNSSRYIADKGIAQVGPGAKWKNVYANLLKNGNVTVTGGRDGDVGVGGFLLGGGN
SYYSGRNGFGSNAVVGYEVVLANGTIVEATVDQYPDLWKSLKGGLLNYGIVTRFDLQTMP
AVDLAYGLNVLTYNYSSQVSDALVDFTNNMEQRPDDHMFILYTDETSSGDGSMMILPIYV
NTKGDLNTTSFDEITKIPSVVSSWERMSLAAAANASQVAGGTKNVQRTLTLYNDAAILRE
ATRLHTQLVATLDEKVGSENYSTQVVFQPLPAYLSTLGLRNGTMSNVLGLERIGSNAILW
TAAVAITNGDDGALAVAGTELSALLTQLEKFTSPDGKPSTAEWVYSNYADMSQDPLTSYG
PENVAFMKEMAAKYDPEGFWQKRVPGGFKLSRV

Enzyme Prediction     

No EC number prediction in PV06_10610-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	58	500	1.6e-41	0.9781659388646288

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.63e-12	69	210	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	3.81e-10	65	243	28	208	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW22693.1|AA7	1.80e-19	43	307	35	298
CDR44461.1|AA7	2.11e-17	69	262	70	258
CBX96933.1|AA7|CBM18	9.00e-17	49	319	193	463
APA09402.1|AA7|CBM18	1.07e-15	48	271	57	276
QRD93627.1|AA7	1.33e-15	31	313	8	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EO4_A	3.17e-13	42	257	22	241	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	3.17e-13	42	257	22	241	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
5K8E_A	7.78e-13	69	259	61	250	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6FYD_A	1.66e-12	46	282	22	249	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYG_A	1.66e-12	46	282	22	249	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0U5GQ05|DRTC_ASPCI	4.57e-70	33	513	45	516	FAD-dependent monooxygenase drtC OS=Aspergillus calidoustus OX=454130 GN=drtC PE=1 SV=1
sp|C8VPE5|SDCF_EMENI	6.41e-69	33	513	8	479	FAD-dependent monooxygenase sdcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sdcF PE=1 SV=1
sp|M2T7Z1|TPCD_COCH5	2.49e-51	69	511	79	518	FAD-dependent monooxygenase tpcD OS=Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) OX=701091 GN=tpcD PE=1 SV=1
sp|G3Y424|YANF_ASPNA	2.36e-42	24	512	99	578	FAD-dependent monooxygenase yanF OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) OX=380704 GN=yanF PE=1 SV=1
sp|A0A2P1DP98|MACF_PENTR	2.61e-42	12	502	28	507	FAD-dependent monooxygenase macF OS=Penicillium terrestre OX=374132 GN=macF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000351	0.999622	CS pos: 16-17. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in PV06_10610-t43_1-p1.