CAZyme Information: PV06_10490-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_10490-t43_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	KN847344.1|CGC7	48775.34	8.0512

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847344.1:390080-391386(-)

Full Sequence      

MRRAPFPYWLRRRRLFFLVALIFCICIFYTLLPILRNHGESNLEAFKDENDSCGRFESTS
VYRQNPDHDLERRIDSALLAIQHREESKAQPNLPVKKIWQTWRDPVVPENFDQPAIWRKL
HPGWEHQVVSDRDAPPLVSDELQTVPYFEHLFSSSYRPIIRADLLRYTLLWHYGGFYADI
DVHPVRSVETCEPMSPLFALDKNMNISLVIGIEVDEPYASVRRRKFWRWDGTHGFIQYAI
YAARPFSPILRRAIVRSIAHSVKHEKEKTPWYRLADRFDNAAILEITGPGMFTEAVLDVL
TESLPSNHSLKLSQRQKDACPEDASVRSSDEQRGRVTWAPFYRLREPSWIFDEDTMDGNT
TQRSGGLGVMPINVWGNGQRHSGSENFHSAQACVNHHFSGTWKQSWLHRTLLKWFHF

Enzyme Prediction     

No EC number prediction in PV06_10490-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	117	191	2.8e-17	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	1.13e-15	117	187	11	82	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	5.03e-14	96	294	84	281	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW37982.1|GT32	1.16e-93	42	407	47	408
QMW25899.1|GT32	1.16e-93	42	407	47	408
QRD88070.1|GT32	1.16e-93	42	407	47	408
UCK58385.1|GT32	1.16e-93	42	407	47	408
BCS21634.1|GT32	1.19e-93	2	409	7	411

PDB Hits     

PV06_10490-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	8.72e-22	96	403	144	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	6.63e-21	85	403	94	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.27e-18	98	352	134	352	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	5.56e-14	96	404	98	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.68e-09	70	227	31	179	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000002

TMHMM  Annotations     

Start	End
13	35