CAZyme Information: PV06_10418-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_10418-t43_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
878	KN847344.1|CGC1	98065.72	4.9970

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847344.1:166076-168712(+)

Full Sequence      

MFRLRRYRVFLVVAVLSILTIYQLSRVNHWDGTTLEGLIGHKPEIDQTTVPDSQRPPNRV
QPEPDKPAAPAETTPPPPAAVSTEAAPTPVPEVAVSSSTSPQDSSPTVTGEESLAKQPDF
DEEFGEHGQGRYEVKNRPPGIGRAVWRPQPAQFPISSESLISLPQGQPQTLPKIQHNFGW
EAPYVKADRKRKQTRIREAFKHAWNGYKNHSMGHDELKPISKKSADPFNGWGATLVDTLD
TLWMMDLRDEFEDAVAAVSQINFKSSARKDIPLFETTIRYLGGLIAAYDISDAKYPILLE
KALQLADILLGAFDTPNHMPIGYYNWAPSYASQPHRAGAHTVMAELGSLAMEFTRLAQIT
KKPKYYDAIARVTNALEKWQMETEIPGLWPLKLDASGCKKPDVVRTAGVEGLSIPFLAGE
IGEGEEPAVNPFSTKPQADSGSKLEKTKTLYRRAADDSPESEKQPGKVDFKPTLDKPVAI
SNQDWEEDYASVDCAAQELDYEPHSTKHTYGIGAMADSTYEYFPKMFALLGGLNTQYKSM
YMDAMDAVRRELLFRPMTKENHDILFAAKQIISPKAVNPSDKKVTIYEGSHLGCFAGGMF
ALGAKLFGISGDMTLATKLTDGCVWSYASTPVGVMPEEFELVPCDGLASCSWDETKWREA
LDPHRKERFRAVEEYNLNQQKLREEAMQGLEDGAVEPISDPSMKKKRDELSKLDDTEPSR
TIVTDDAATEEEGEEAGIPPPPFVPRVPLSHEKYVAARLLEERLPPGYTKIGARDYRLRP
EAIESVFIMYRVTGDESWREKGWTMFDAVERATKTDVAHAAIKDVTSQLGEQSDSMESFW
LAETLKYYYLLFSEPELVSLDDYVLNTEAHPFKRPGSH

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	199	874	6.3e-175	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	199	874	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.20e-97	164	875	35	519	glycoside hydrolase family 47 protein; Provisional
397265	4HBT	0.003	228	290	5	68	Thioesterase superfamily. This family contains a wide variety of enzymes, principally thioesterases. This family includes 4HBT (EC 3.1.2.23) which catalyzes the final step in the biosynthesis of 4-hydroxybenzoate from 4-chlorobenzoate in the soil dwelling microbe Pseudomonas CBS-3. This family includes various cytosolic long-chain acyl-CoA thioester hydrolases. Long-chain acyl-CoA hydrolases hydrolyze palmitoyl-CoA to CoA and palmitate, they also catalyze the hydrolysis of other long chain fatty acyl-CoA thioesters.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX63570.1|GH47	1.32e-234	121	877	144	899
QSS63392.1|GH47	9.54e-231	121	875	136	861
QSS69163.1|GH47	2.45e-230	121	875	132	858
QSS51165.1|GH47	4.89e-230	121	875	132	858
BCS01562.1|GH47	1.55e-225	104	875	113	869

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	1.51e-42	192	871	5	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.70e-42	192	871	10	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.76e-42	192	871	10	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	6.66e-42	192	871	88	531	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	7.31e-42	192	871	5	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8H116|MNS2_ARATH	1.85e-46	192	873	98	536	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	2.06e-46	181	873	87	535	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|P39098|MA1A2_MOUSE	2.63e-43	190	871	178	623	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|O60476|MA1A2_HUMAN	3.54e-43	188	871	176	623	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
sp|D4AV26|MNS1B_ARTBC	3.54e-42	155	873	9	506	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000025

TMHMM  Annotations     

Start	End
7	24