CAZyme Information: PV06_10336-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_10336-t43_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		40564.38	6.1378

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847343.1:515458-516552(+)

Full Sequence      

MLSFFVVVFTLLHIQSHASRLPERRSHLYPRAPSSNCDVYVVSGQDTKFENYAFTDFRSL
SNYSISEPPSVTDADNQGEENITSPYFAQPPFSDQWTIRRGIRNAESDVPMIYSASNAYI
SKDPSDSSQTYLTLRTTRVQDFQSVVQLVSNPKLLHASMRTRMKILPDGKDRDGVAKGAV
VGFFTYEADTQETDIEILTQDPSTTVELSTQPASSDTPGADASVKIPNGKKWTDWVDYRL
DWFAGKNVWYMDGEMMYNTTKSVPTVPSNLMFNLWSNGQSFSGKMRVGREVYVAVQWIEI
AYNLDGQGQSSNGTSGQTQCSVDSGKTKGSPEVIKNSSAKRSAVSRVLKIANSIVFALIA
WYCI

Enzyme Prediction     

No EC number prediction in PV06_10336-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	95	300	9.5e-61	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	6.35e-39	91	300	8	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	3.52e-08	178	298	82	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
225182	BglS	0.001	177	325	131	287	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO63760.1|CBM1|GH16_22	2.95e-52	29	338	27	346
EAA63092.1|GH16_22	7.47e-51	27	310	40	341
CAE7012560.1|GH16_22	1.57e-50	30	334	36	354
BCS29547.1|GH16_22	5.52e-48	26	315	31	343
CBX92358.1|GH16_22	2.26e-47	30	334	35	344

PDB Hits     

PV06_10336-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

PV06_10336-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999745	CS pos: 18-19. Pr: 0.9791

TMHMM  Annotations     

There is no transmembrane helices in PV06_10336-t43_1-p1.