CAZyme Information: PV06_09802-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_09802-t43_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		42624.82	5.8350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847342.1:262196-263528(+)

Full Sequence      

MISPSIVLTLGLALFSVPGISSLLPRQAKNKPWSVSNFHSLLTFGDSYTDESRLGYFIQN
NGSAPPAGVLLPESNSTAGGGRTWPRYVVQYTGSTKNGEWDPSMTLYNYAVSGAVCSNKI
TPRWFSAINAPFPSVLEYEIPAFQADMKAQRVNATPAEPYFTTGLSAQSALYALWIGTND
LGVWAFVTDSQIRGKVLTDYTSCVYEVFDKLYAAGGRMFVLMNTAPLHLAPLYANSTLHG
VGPNQYWPNKTSNHTQISETMHEYTSTVNNVFKYQTPFELMVANRYPDAHFAVFDMYSLI
SDVYDNPTAYLNGTDVKAGTETVRGYINHCNVNQTVCVKMDNNGTNPDGFLWYDELHPSE
QTDRVIARNFVEVLNGTSKYATYY

Enzyme Prediction     

No EC number prediction in PV06_09802-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	41	370	3.3e-68	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	2.55e-41	40	373	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	6.45e-16	108	370	79	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	3.51e-12	8	367	2	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
395531	Lipase_GDSL	3.43e-05	41	312	1	206	GDSL-like Lipase/Acylhydrolase.
238883	Triacylglycerol_lipase_like	9.67e-05	38	374	1	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14322.1|CE16	2.75e-118	33	384	36	357
QMW44554.1|CE16	8.04e-114	19	384	9	353
QRD84022.1|CE16	8.04e-114	19	384	9	353
BAE62044.1|CE16	8.04e-114	19	384	9	353
QMW32524.1|CE16	8.04e-114	19	384	9	353

PDB Hits     

PV06_09802-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	2.08e-94	37	384	26	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1
sp|Q94CH5|EXL5_ARATH	4.00e-06	177	372	181	351	GDSL esterase/lipase EXL5 OS=Arabidopsis thaliana OX=3702 GN=EXL5 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000332	0.999639	CS pos: 22-23. Pr: 0.8514

TMHMM  Annotations     

There is no transmembrane helices in PV06_09802-t43_1-p1.