CAZyme Information: PV06_09469-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_09469-t43_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	KN847341.1|CGC5	39400.83	4.3495

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847341.1:811510-812871(+)

Full Sequence      

MISSAALVAVVSLLSAAPVVLAQTCTPCEDVHFFLARGNNEPYPGRQGDLVAATCDGLSS
CGYENLIYSALYTDLSCQTTYDGVIAGFTQLTSYAERCPKSKLILAGYSQGAQIVTDILG
GGGGESFNGCIQPNTPPLDPTTSPGNRLSAVLTFGNTRHTANQPYNYGNGSGIDGLFPRS
GDMLTALDKYTAVTRDWCLQTDPICAANQTDSLVSTHLGYYNMYSDEAAAWIKSVAGLVD
NSDFTTAIPTYVSGTVQDYSTVGTATPSGSVSTVATTTPSINCGGSSTTPVIAALTSANA
TATSSGSLITSKPHANSTMSTAAITSGPPFIFGGPDTTTASATVSGGASSTNSVAIQSQT
GAANSNNKVGSFGLTALLLPLLGALAM

Enzyme Prediction     

No EC number prediction in PV06_09469-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	27	234	1.1e-35	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.88e-14	27	234	1	171	Cutinase.
215130	PLN02217	3.27e-04	251	369	557	663	probable pectinesterase/pectinesterase inhibitor
411147	PACE-CTERM-PROT	0.007	234	371	16	160	putative S-layer protein. Assembled genomes from the Candidatus Pacearchaeota archaeon group and its close relatives, so far all uncultured, have a single archaeosortase, called pacearchaseosortase. A search protein archaeosortase targets, with a C-terminal domain resembling other archaeosortase and exosortase sorting signal regions, found this family as the best candidate. It is nearly always encoded by a gene found adjacent to the pacearchaseosortase gene. This dedicated arrangement, a sorting enzyme encoded next to its only predicted sorting substrate, suggests that members of this family, called PACE-CTERM, may be an important and abundant surface protein, most likely the major S-layer protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63722.1|CE5	7.89e-74	1	234	45	274
QGI63982.1|CE5	1.13e-73	27	235	30	233
QGI81251.1|CE5	1.13e-73	27	235	30	233
CCT68028.1|CE5	6.35e-73	27	235	30	233
UPL04270.1|CE5	1.93e-71	16	233	6	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	1.02e-11	43	237	33	207	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.02e-11	43	237	33	207	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
1QOZ_A	8.64e-11	41	234	31	204	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
2AXE_A	8.64e-11	55	237	46	207	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2J8C362|CUTI1_VERDA	3.92e-13	3	234	3	227	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|O59893|AXE2_TALPU	7.85e-11	43	237	60	234	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	1.26e-09	41	234	62	235	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|P0A537|CULP3_MYCBO	7.15e-09	28	232	44	222	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|P9WP39|CULP3_MYCTU	7.15e-09	28	232	44	222	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999792	CS pos: 22-23. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in PV06_09469-t43_1-p1.