CAZyme Information: PV06_09197-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_09197-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
917	KN847340.1|CGC4	103305.77	5.9249

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847340.1:1752225-1755039(-)

Full Sequence      

MASPPRTPRRLQKRRPTPIQPPNTPQNELSERASPSKATLRDGISPDFAVVSQEDGSESL
PDTPFTSPTAHLSVQRESQIDKFKFEVRLLYLRQQQLQNRWADEESGEGVLLKTGKGNYI
SQPRELADACGGFSEQMRKLNVKVAMTVKTPVIETFLATYKPQYVPYTQGQRISIIDSID
QVCQAHRHHYAVFVRGAGLLAVWDEDAVEITDRATRIEKHLVDLVWAMSSEQESDIHTKE
SFEQPAREESKAPVVATPQPLPAISEKDAETGAPEAPRQTLLWQALVVGCAGCLTIFCLS
IGWRALAVEIKYDHSWTRILLVIVSPLQLWLGWFFFMTVCTTIAQLVGPVKQVFQNSKFY
SAVPTKRLRDNLPHVTIQCPVYKEGLDTVIIPTVVSVNKAISTYELQGGSASIFVNDDGM
QLIPEEEARRRVQFYEDNNIGWVARPKHAPNGDSNGQNVFVRAGKFKKASNMNYCLSVSS
RVEDKMAEVERTPNWTQEDEDQLYSSAFEAIIKEDQGRTWGAGNIRMGDFILIIDSDTRV
PEDCLLDAVSEMTATPEVAIIQFMSGVLNVTTSFFERAITFFTNLVYTSIRFAVACGDVA
PFVGHNAMLRWSALQDVAYVDTDGTEKYWAENTVSEDFDMALRLQSLGYVIRYSTYCGDG
FKEGVSLTVYDELIRWEKYAYGCAELLFHPFYKWPLHGPVTPLFRRFITSPISWMGKLTM
MSYIGTYFAIGSAWALTLLNYFLLGWFNGHLDKDYAESFNVYFGLVIVFQGAGTVSLAVL
RYRVEGRSLFKCLLENMTWMLVLTVFLGGISLHVSGALLFYLFGIDMSWGATAKEATDTS
FFREIPVIIKKFKFTFVYCILSVAMMMVLAGIGPLGKLVPEFWRINSFIAIYPQAIMIAM
HFFLPLALNPGLMQFAF

Enzyme Prediction     

No EC number prediction in PV06_09197-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	531	747	4.7e-52	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	4.87e-51	530	747	1	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.34e-15	528	836	138	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	6.22e-12	528	637	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133029	GT_2_like_c	3.88e-07	511	653	53	156	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
215121	PLN02189	6.32e-07	624	893	727	987	cellulose synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO15800.1|GT0	1.46e-308	76	917	62	888
USW53192.1|GT0	8.32e-308	28	915	23	886
SMQ45410.1|GT0	1.38e-302	80	917	65	883
SMY19115.1|GT0	1.95e-302	80	917	65	883
SMR43958.1|GT0	2.10e-298	80	917	65	900

PDB Hits     

PV06_09197-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q83Z42|OPGH_XANEU	2.80e-07	531	739	241	431	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas euvesicatoria OX=456327 GN=opgH PE=3 SV=1
sp|Q3BXV7|OPGH_XANC5	3.69e-07	531	739	241	431	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=opgH PE=3 SV=1
sp|B0RNI5|OPGH_XANCB	4.86e-07	531	739	241	431	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=opgH PE=3 SV=1
sp|Q2NYU0|OPGH_XANOM	4.86e-07	531	739	241	431	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) OX=342109 GN=opgH PE=3 SV=1
sp|Q4UYZ8|OPGH_XANC8	4.86e-07	531	739	241	431	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

Start	End
281	303
315	337
723	745
758	780
800	822
854	876
891	913