CAZyme Information: PV06_08371-t43_2-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_08371-t43_2-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317		35850.91	6.7198

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847339.1:1189396-1190404(-)

Full Sequence      

MHNSAIPLILHQTWKTRYANKWSDLLRNSVESWLQHVVRDEMAYFFWEDDGIMQFLHEFE
PDFVETFVNLPANVERTDIFRILVVKWFGGVYADIDTQPLRQPKYWVTPDDVAPWTDPMT
NKTFNSTTPVGLIFGLEADCPPMSDDYWRMGYTFPLQLTQWALASAPAHPVLLHFMDILT
HWLGEIAAQNNGTITTPSAIKQLHHIGPLALTGPQAVTIATKSWLKGQAGLRWNALTGLD
DGGRSKLVEDVLILPITGFSPGRGRYGNMGSKPVTDPAARVWHRAQGSWRSFDAVAEFGK
VCRSLFGLCKHWSKGQD

Enzyme Prediction     

No EC number prediction in PV06_08371-t43_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	26	107	3.1e-16	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.04e-13	5	172	81	236	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.82e-10	23	101	1	81	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX57092.1|GT32	8.79e-143	4	314	104	414
QGA12609.1|GT32	2.88e-140	1	314	107	420
BCR93027.1|GT32	1.19e-132	3	314	96	406
BCS05686.1|GT32	1.19e-132	3	314	96	406
CAK38082.1|GT32	1.19e-132	3	314	96	406

PDB Hits     

PV06_08371-t43_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.41e-24	2	290	138	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.97e-20	3	297	96	382	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	9.24e-13	4	290	94	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	1.00e-12	61	172	183	277	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	3.00e-11	3	107	54	159	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000078	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV06_08371-t43_2-p1.