CAZyme Information: PV06_08371-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_08371-t43_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		46936.72	8.4830

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847339.1:1189396-1190797(-)

Full Sequence      

MRVACLSSRRIFPSVLFSIFFFWYFLPVRNHGPRKVTSAQLQQDHPLLYKHVHSFNGTGG
TWYIPPHWLPAPNIQPENIVDAALLASHAANASKHRKMHNSAIPLILHQTWKTRYANKWS
DLLRNSVESWLQHVVRDEMAYFFWEDDGIMQFLHEFEPDFVETFVNLPANVERTDIFRIL
VVKWFGGVYADIDTQPLRQPKYWVTPDDVAPWTDPMTNKTFNSTTPVGLIFGLEADCPPM
SDDYWRMGYTFPLQLTQWALASAPAHPVLLHFMDILTHWLGEIAAQNNGTITTPSAIKQL
HHIGPLALTGPQAVTIATKSWLKGQAGLRWNALTGLDDGGRSKLVEDVLILPITGFSPGR
GRYGNMGSKPVTDPAARVWHRAQGSWRSFDAVAEFGKVCRSLFGLCKHWSKGQD

Enzyme Prediction     

No EC number prediction in PV06_08371-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	123	204	4.7e-16	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.59e-13	102	269	81	236	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.05e-09	120	198	1	81	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX57092.1|GT32	1.29e-160	39	411	42	414
QGA12609.1|GT32	5.64e-156	33	411	39	420
BCR93027.1|GT32	2.83e-154	41	411	37	406
BCS05686.1|GT32	2.83e-154	41	411	37	406
CAK38082.1|GT32	3.26e-153	41	411	37	406

PDB Hits     

PV06_08371-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.88e-23	99	387	138	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.35e-19	104	394	100	382	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	2.31e-12	158	269	183	277	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.04e-12	103	387	96	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.10e-10	100	204	54	159	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999958	0.000053

TMHMM  Annotations     

Start	End
7	26