CAZyme Information: PV06_08070-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_08070-t43_1-p1
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595		63136.43	4.4715

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847339.1:61679-63576(+)

Full Sequence      

MPFRQRIKELFGSCFREPTTGEDLQAPQPLPQPLPDVGKDDGVCSPRPAFTTENTHHPST
GCPHTDLYIPFSAITTYVKPINILPTLHLAPLTLITLLVLSNLIAVSAFDLAFERDLGVV
ASANSLSERNEPARELHRKPQVRKHHTVGPPWSCPFFPVHPLPPFGDPFVPGFPNPFPGF
AGHTHFPEPVITVHTSQIITSIPTTSVGGQFTTALSPQPLTNTSQSVTSDASTSTISDTD
TSGSPASASGASPVFGVSSTSAFASSVVPYTSSSSTAAPSTNSDSSTIFNSNTASSSTTD
SSSSSASSAITSVTTPVPANTSTSSVSTTNPSAPAQTSDVVQVGNQWLVPGVGTFDNRSL
FTFDQGFPDGLQISNYSNHQRGSGPSPEIPYNPTFDPANVQIVNGMLALTVPGDQNPNNS
TGWEVSSAEITTAESSILYGSVRTKAILSPVPGTCHGFFFYQSDTQETDIEYLTDPSSLS
NNGPGNPIPIWYTNQAVNPEDEAATQATGPAPSDCTTAVHEYRLDWTSDYTAFYLDGKFQ
MKFTTNVPSEPGPWVWNNWSNGNKGWSVGPPSSDNILLIKSIDMYYNTDSGGSGP

Enzyme Prediction     

No EC number prediction in PV06_08070-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	421	585	1.6e-42	0.8697916666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	8.43e-35	378	585	14	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185693	GH16_laminarinase_like	6.29e-08	369	557	6	198	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185684	GH16_lichenase	2.43e-05	390	571	24	195	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185692	GH16_fungal_CRH1_transglycosylase	0.004	436	538	44	136	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	0.005	395	538	1	123	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI62369.1|GH16	1.46e-59	344	588	36	262
QGJ01524.1|GH16	7.82e-59	347	588	39	262
QGI70634.1|GH16	7.82e-59	347	588	39	262
UPK95868.1|GH16	1.06e-58	346	588	38	261
QGI87979.1|GH16	2.14e-58	347	588	39	262

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WVJ_A	6.28e-07	391	559	31	186	Chain A, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45797|GUB_PAEPO	6.25e-08	367	589	30	238	Beta-glucanase OS=Paenibacillus polymyxa OX=1406 GN=gluB PE=3 SV=1
sp|A3DBX3|GUB_ACET2	7.42e-06	391	559	60	215	Beta-glucanase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=licB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000003

TMHMM  Annotations     

There is no transmembrane helices in PV06_08070-t43_1-p1.