CAZyme Information: PV06_07697-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_07697-t43_1-p1
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
762		81976.88	7.4062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847338.1:1102919-1105207(-)

Full Sequence      

MSQMINSSSLASLPSPLFQAPATEVFTETQLETLFSILEVTVPSIVAGSNVSKEQLESAV
SRIKPYLPEGASDKLARAYLSEDIVASPAFRETVIRKFKLYIPPTDAQGLAFIFSALNTT
IGSYLLTGYSSPIQTQDLATRTRIVNGWSTARLPLLRAIYRSMDGLARMAWSTTSPTLPQ
VIDFPSVPRHIERNDSYDFKFHDFTSPATPTHLSTDVVIVGSGCGAGVVASHLSRAGLKC
LILEKGYHFPSSHFPMSAPEAGEHLMENGGMIAADDNNIVVLAGSTLGGGGTVNWSASLQ
PQYAVRKEWSDGGLPHFLSSEFQDCLDTVCGRMGVSSTTDPATLANIEHNVANKTLLEGA
RRLGMAVEIVPQNTAAKKHNCGYCSYGCPSTTKQGPANCWLPDAGVHGAEFIEGAFAEEI
IFSQKGNRKVATGVKVLWTSRDRQTKRTLHVSAERVVLAAGTLNSPLVLLRSGLKNPNIG
ANLHLHPTGQVWSVWPERTNPWEGSILTVAVTEHQNQDGANHGPKLETIFSTPAFGLLVL
PSRVPAGGASDDVFDPALEFRVNAAKYGFSTGFISITRDADPGRVYIDPKDPERKRARIT
YVPSARDRGHVLEGQIAAARVCFVMGAVEIDTGHARVPRWVRPSSSSRPGKKEDEDERSF
TEWLGVVRTTGLTVPDPYMLGSAHQMGTCRMSPSPQTGVVDAHGKVWGVDGGLYVADASV
FPSASGVNPMITNMGIAEYISRGIVRETGKTTATTTGRGSKL

Enzyme Prediction     

No EC number prediction in PV06_07697-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	207	754	1.3e-53	0.5258899676375405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	6.62e-62	263	488	2	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	6.16e-47	208	747	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.34e-29	583	740	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	3.57e-07	412	741	219	528	choline dehydrogenase; Validated
274143	pyranose_ox	5.03e-05	684	745	483	543	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	6.97e-153	11	747	6	733
QYS99722.1|AA3_2	1.71e-10	390	739	192	586
UKZ52598.1|AA3_2	2.05e-09	389	739	189	584
QRC92500.1|AA3_2	2.50e-09	427	749	235	534
UJO12159.1|AA3_3	3.57e-09	216	749	17	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F97_A	3.74e-08	432	747	244	530	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	8.57e-08	432	747	244	530	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
4UDR_A	1.36e-06	432	747	244	530	Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688],4UDR_B Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ8|FAO1_LOTJA	4.47e-74	216	745	238	741	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q9LW56|FAO3_ARATH	4.09e-73	213	746	231	738	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	2.05e-71	216	745	239	739	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|B5WWZ9|FAO2_LOTJA	2.12e-71	213	750	237	748	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|Q9ZWB9|FAO1_ARATH	3.80e-63	213	744	244	748	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV06_07697-t43_1-p1.