CAZyme Information: PV06_07589-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_07589-t43_1-p1
• CAZy Family: GH64
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543		60334.34	5.5519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847338.1:810050-811744(-)

Full Sequence      

MVSNACTDAIVDMKFQPVRQPSEGVIRAQLKRLVPFCIVGIFFMLYRNAIAGVSGSDNSI
SLVDKIPRKIWQSWKHDPFGMELRDSERAKTWTTKNPNYRYEVLTDDNAMPYVEYHYGPH
GLNRPDIVHTYRTLSDKIIKSDLLRYLIMYAEGGVWADIDVEALKPLDMFIPDRFDERDV
DMIVGVETDMPEFASHSLLGSKCQSFVQWTFACKPRLPAMMRLIDGILAWLNDLAKKQGK
PISELELDFDEVISGTGPSAFTKAILAEISKIRGQKTTWDTFHNTLEAKLVGRVLVLTVE
AFAAGTGHSDSGNHGGKGALVKHHFHASSWPTSHPRYKHPVYGEVEKCNWNSECVKLWDA
NTKFFDSLPAQEQVKLIAMKELEDANAPKPEEEAPFGAGVNRQPDGGVPFQQAPFGQGNQ
PPDAAWYPEDPEFFDGPGPMPDAQPNVVPGGGANKPEAKKQPAAADEKKADGPVAPAKPE
AKVEDKKVDAKPEAKPEAKPEAKSDPNPDEKKGDDPVAKPEEKKDEEKQDNKKPADKPLE
LRS

Enzyme Prediction     

No EC number prediction in PV06_07589-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	89	172	2.9e-21	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.34e-20	56	292	72	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.58e-14	90	176	9	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
411408	PspC_subgroup_2	6.89e-06	388	516	354	499	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.
411408	PspC_subgroup_2	4.02e-05	344	512	254	417	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.
236940	PRK11633	5.24e-05	412	508	66	145	cell division protein DedD; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW40889.1|GT32	9.04e-163	29	405	9	387
BAE58544.1|GT32	9.04e-163	29	405	9	387
UDD56882.1|GT32	9.04e-163	29	405	9	387
QMW28814.1|GT32	3.64e-162	29	405	9	387
QRD83354.1|GT32	4.19e-162	29	405	13	391

PDB Hits     

PV06_07589-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.30e-30	66	330	142	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	7.39e-27	10	302	97	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	2.55e-22	13	330	67	375	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	4.79e-21	66	245	96	300	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999934	0.000085

TMHMM  Annotations     

There is no transmembrane helices in PV06_07589-t43_1-p1.