CAZyme Information: PV06_07057-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_07057-t43_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613		65684.80	4.1820

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847337.1:1750965-1753030(+)

Full Sequence      

MLSFFLLSLLSVTGRGHPHAKVELQRRGDDVDLCVFDGPPSVVTVTVPTVSTVVRTSIFT
RYVPVPTDWPGVQGWLAAGSPSDDGSDSGSQAQGASSPPWGSGPPPWWKPWDEVDVDGAQ
GSAGQAGQSGQSGQAGQSGQPGQPGQPGQSGQSGQSGQSGQSGSGSGWFWPSSVEISSGG
PNPTSSNIWTSLTTSASPSSTSNVSTFTTSIGTSTTLSTSSHSSSPTPNPDDWPDHTVTA
YYGAGNTDIFPPRNIPWKYLTHLCFAFANTNGVNNNYSISIDNTDLLRYLSVQAHSHGVK
LVLSIGGWGRGGMYYSDIVQSNQSISAFVQSVEAVVSEYGISGVDIDWEFVGNLHDAPEP
AQPRLVTDADGYLQMLTALRAAMPSTELSAAVPMYVFKKPDGTDGTLVPVDMHPFVPLFD
RLYLMAYDLWNGDDTAGSNAALVRNGDVPQDQRFGDDGVKTWHDAGFPMSKLVYGVPFYG
YGYLLSEGSNPEATGLYSPVSDKSSGDSNEDPNKNSGFWKWRNLKSQDVVQQQPDGSYRA
GPGWVYGFDDATQTPYIYTDDNNTTNDPQIISYDDPDSIGLKREYAKQQGMNGMMFWAMY
GDTDDGELTEVLR

Enzyme Prediction     

No EC number prediction in PV06_07057-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	237	606	5.3e-61	0.9459459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	2.06e-58	250	602	16	334	Glyco_18 domain.
395573	Glyco_hydro_18	1.62e-55	237	602	1	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.99e-51	240	602	9	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	2.91e-42	250	605	18	342	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
225862	ChiA	2.84e-39	238	604	40	425	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV87962.1|GH18	1.66e-46	226	613	108	501
QRW02133.1|GH18	2.19e-46	226	613	142	535
QRV73087.1|GH18	2.29e-46	226	613	108	501
CAC35202.1|GH18	4.64e-43	235	612	47	425
ABB90389.1|GH18	1.45e-42	235	605	37	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	2.67e-48	252	613	14	366	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
3WL1_A	1.18e-35	253	605	29	360	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]
3WKZ_A	3.00e-35	253	605	29	360	Crystal Structure of the Ostrinia furnacalis Group I Chitinase catalytic domain E148Q mutant [Ostrinia furnacalis]
3WL0_A	7.64e-35	253	605	29	360	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain E148A mutant in complex with a(GlcNAc)2 [Ostrinia furnacalis]
3W4R_A	1.14e-34	253	605	47	378	Crystal structure of an insect chitinase from the Asian corn borer, Ostrinia furnacalis [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36362|CHIT_MANSE	1.96e-33	253	605	45	376	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q6RY07|CHIA_RAT	1.27e-25	250	605	41	366	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|Q91XA9|CHIA_MOUSE	7.81e-24	250	605	41	366	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
sp|P11797|CHIB_SERMA	1.72e-23	250	612	31	418	Chitinase B OS=Serratia marcescens OX=615 GN=chiB PE=1 SV=1
sp|Q9D7Q1|CHIT1_MOUSE	1.01e-22	250	605	41	362	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002342	0.997619	CS pos: 16-17. Pr: 0.9360

TMHMM  Annotations     

There is no transmembrane helices in PV06_07057-t43_1-p1.