CAZyme Information: PV06_06391-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_06391-t43_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1018		115729.75	7.3439

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847336.1:3042325-3046774(-)

Full Sequence      

MEIPSQEHLHVFDYPSSSPSSSYSSTPSRAVSRCSSSISPRASGRKTEILAKYLFRKCDQ
QKWFEAHDQELSDVSTSDHVGVILRAEDGTYYCEPASINNACVRAASHLNASAGLCMRSG
AVLELLDQISFEDTHLELGSSGVDLHIVSTVADIANFASGLRLDTCLFLCKKESMIFILV
DHHQVLLKRGWYVEDLLIEHIYGNQGLDGYPQTSRTDSRSHTEHSNHRVQDQRRPNTEVL
PYVPEAALEDPTMKEKINVIQAALDKEVHGDQLFDPEKEGQEAPKRKLLLRHAVMVSIAM
ILVVVVEMACIAKMVTEVQLDRNYTRFALLCLVPMFALFSLFFMIVVCGSLWQIFGPLSS
LKQNSKYYSAIAPKPGRYPDLELPHITIQMPVYKEGLQGVIIPTITSVMQAVKYYEAQGG
SASIFVNDDGMQLVSQDLADARKAYYEINNIGWCARPPHKEKGKKKSWGRKAEKTNDEEA
ETSTSYFLRKGQFKKASNMNYCLDFSLRVEDQYLAMVDTICQERGCTPEQLDPEEGNRIY
QQARDHVVANDNGRTWAAGDVRVGSIILIIDSDTRVPENCLLYGALEMHESPEVALIQHA
SGIMQVVHNAFENGITYFTNLIYTSISFAVGMGDCAPFVGHNTFIRWDALQSIAWFDEED
KCTKFWSDSHVSEDFDVSLRLQMNNFVVRLATYHEGGFKEGVSLTVYDELARWEKYAYGC
NELVFNPLYKWPYKGPITRLFWRFLFSNIKITSKITILAYIGTYYAVASALPLSLANYLI
VGWFANEIDQFYLTSWKVWVGMMIVFNVLSPIGYAMLRHRMGKTTFFRSLWDTIKWTPMF
LLFFGGVSFHLMKALLCHFFSIKMEWTTTAKEYNGGFRIGLDRIVRDFKWMYLIIIVLTA
GMIYLDQKSSDWHKYRRCDAFRYSRKVPSESFRAQPRVTKGGNIPFILPKRRKIIPSDPR
NMPSTSPPGPFETIPPRGTLWRLGLLADPAKQHESIAEEMRKYSPSQVSTSIHGKKAT

Enzyme Prediction     

No EC number prediction in PV06_06391-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	566	801	9.7e-54	0.9543147208121827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.38e-52	566	781	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	3.22e-10	556	872	131	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	2.98e-09	564	674	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW95398.1|GT0	0.0	49	905	48	885
QSZ28760.1|GT0	0.0	49	905	66	902
APA12832.1|GT0	0.0	49	905	66	902
ATZ55570.1|GT0	0.0	49	905	66	902
QKD61408.1|GT0	1.92e-259	40	905	76	926

PDB Hits     

PV06_06391-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

PV06_06391-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

Start	End
293	315
327	349
763	785
798	817
840	862
888	905