CAZyme Information: PV06_05680-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_05680-t43_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	KN847336.1|CGC3	50810.27	4.7459

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847336.1:842057-843546(+)

Full Sequence      

MTRGFNFLTALIAFLPLSSLAQSSSSCGPVPSGAIKPSVASGFAVQVVATGLSKPRGLHF
DNAGNLLVVEQGRGVVSAHTLNENEGCISVESSVDVTSRLNLNHGIEMSNDGKTLYASSA
EAVYSWSYDESARTVSNQARIVANMTTNDHTTRTLLLSQKAPGLLVVTRGSTSNIDIDAA
SLASGHSQVKAFNLTNRTGVYDFDIDGLRLGWGLRNDVGVAEHPASGGIYTVENSADQLT
RMGVDIHEDNPAEELNFLGYLNGREYAAQGGNFGYPWCFSAWGVGDLPDNGNLTVGSQYA
VDASPDSNNQNKTDAYCAQQEPARLVFQAHMAPLDIKFNHSGTEAWVTFHGSWDRTQPVG
YKVSVVAFDKDGEPVDSLDSKDAARDVLTNQDNSKCPDDCFRPAAMALDLHGRLYVSSDA
SGEIYLITRASGTKLPGPTPTSSSTSTSTATNIAGSIGYAWSSGAGQLSFISMLLALLL

Enzyme Prediction     

No EC number prediction in PV06_05680-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	28	427	2.8e-162	0.9925187032418953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	2.46e-23	29	395	43	390	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
380207	ScyE_fam	6.69e-04	46	74	1	29	ScyD/ScyE family protein. This family includes ScyE, a protein involved in scytomenin biosynthesis and export, and its paralog ScyD. Some members of the family contain a C-terminal PEP-CTERM domain that predictions anchoring to the outer membrane.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS74351.1|AA12	1.42e-144	18	439	16	436
QIX02148.1|AA12	6.46e-132	10	433	10	434
UKZ85601.1|AA12	3.41e-130	8	433	7	436
EAA30888.1|AA12	2.27e-128	10	429	10	448
CBX92733.1|AA12	9.69e-128	1	435	1	442

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	9.54e-119	37	430	11	403	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	9.85e-119	37	430	12	404	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	1.02e-118	37	430	13	405	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	3.30e-70	26	429	4	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O51055|Y024_BORBU	1.18e-07	5	369	10	323	Uncharacterized protein BB_0024 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0024 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000283	0.999700	CS pos: 21-22. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in PV06_05680-t43_1-p1.