CAZyme Information: PV06_05669-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_05669-t43_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	KN847336.1|CGC8	31610.08	4.2592

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847336.1:791927-792912(+)

Full Sequence      

MRPAQLLAFVAALPSTLAAYKGFNYGSTGRDQAAFEADFNSAKNLAGSSYTSARLYTMIQ
DGTTNTPISAIPAAINTGTSLLLGLWASGDTFANELAALKAAIEQYGSSLGPLVAGISVG
SEDIYRITPIGIENHEGVGAGPAVIQNYISQVRSAIAGTPLSGAPVGHVDTYNVWTNSSQ
NALIGDCDFLGVDAYPYYETTKANSIGNANATFWDDYSVTVAASQGKPVWITETGWPVSG
PSSGQAVASVDNAKTYYDDVACHAFAKGVNTWWYILQDTGASPSFGLVGAGSPPPTTPIY
SLSC

Enzyme Prediction     

No EC number prediction in PV06_05669-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	22	279	1.6e-16	0.9003215434083601

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.62e-27	21	271	46	276	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.52e-05	13	304	12	309	Glycosyl hydrolases family 17.
381626	GH113_mannanase-like	0.002	171	274	162	281	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAL86311.1|GH17	1.10e-114	1	304	1	310
QIX00265.1|GH17	2.84e-110	1	304	1	309
BAE54624.1|GH17	3.60e-109	1	304	1	310
CAY05237.1|GH17	3.60e-109	1	304	1	310
UCK57187.1|GH17	3.71e-109	1	304	1	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.56e-23	70	290	83	284	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.10e-22	70	290	83	284	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG16|EGLC_ASPFU	1.95e-115	1	304	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	2.21e-115	1	304	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	1.02e-113	1	304	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	6.39e-110	1	304	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	2.12e-105	1	304	1	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999729	CS pos: 18-19. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in PV06_05669-t43_1-p1.