CAZyme Information: PV06_04732-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_04732-t43_1-p1
• CAZy Family: GH152
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547		57239.11	4.2682

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847335.1:1692270-1694085(-)

Full Sequence      

MKGFTAAALAGAALFLTAKADVDPIVIKGSKFFYQTNGTQFYIRGIAYQQDYLGNGTTAG
SSGGSNSYVDPLADSAACKRDIPYLQQLRTNTVRVYAIDPTKNHDACMTALADAGIYVIA
DLAAPGQSIIRDSPSWNDDLYGRYTSVVDAMANYTNTLGFFAGNEVSNNSTNTDASAFVK
AAVRDMKAYIKQKNYRPLGVGYATNDDADIRENLANYFDCGQSSQSIDFWGYNIYSWCGD
SSYTESGYDVRTKEFSTYNVPVFFAEYGCNTVQPRKFTEVQALYGDQMSPVWSGGIVYMY
FQEANNYGLVSVDGNSVSTLDDFNYLSSQLASIDPTGVNSASYTPTNTAAAACPTVGSDW
QASSNLPPTPNEQLCDCMFKALSCVPDNVSNDGVGDLFGVVCGLGQGTCAGITANGTEGV
YGAYAMCNPSQQLGFALNNYYQQQLSAGSGASACDFSGSAKTQSPVNPTGTCSKLISQAG
SAGTGTVTSQPSGTGSSGSGSGSGSGGSSKSSSAGMPSFSTPAHVGLLQAVSFLAVAFVS
GAGMILL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	19	332	1.8e-139	0.9903846153846154
CBM43	384	473	1.6e-16	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	3.61e-173	20	334	7	315	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	9.48e-23	382	460	1	75	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	5.90e-14	382	473	1	84	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA29359.1|CBM43|GH72	7.75e-229	1	485	1	487
UJO23972.1|CBM43|GH72	7.75e-229	1	485	1	487
ACY64759.1|CBM43|GH72	1.73e-225	20	547	20	528
EAL84955.1|CBM43|GH72	3.39e-225	8	485	6	478
EAL89081.1|CBM43|GH72	8.52e-222	9	547	7	541

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	8.91e-129	25	441	36	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	2.51e-128	25	441	36	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	2.51e-128	25	441	36	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATC3|GAS1_ARTBC	3.09e-218	20	485	20	495	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1
sp|B0XVI5|GEL4_ASPFC	2.01e-192	29	482	43	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	2.01e-192	29	482	43	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|P0C955|GEL3_ASPFU	1.14e-185	26	485	17	474	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	1.26e-185	26	485	17	474	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999731	CS pos: 20-21. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in PV06_04732-t43_1-p1.