CAZyme Information: PV06_04604-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_04604-t43_1-p1
• CAZy Family: GH130
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
933	KN847335.1|CGC4	104318.28	4.7867

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847335.1:1292849-1295707(-)

Full Sequence      

MFVSLLIFSLSLLGAPFSSLAQNVTPLSELQWTLTNPNHSISVPGHVPSQAHLDLHDAQV
ISDPYYGLNDFNLRWVAETNWTYTASLASLNLSSNATTWLVFNGLDTFSTISVCNQQIAS
TDNQFRQYYFDVTKALTGCNSPTITINFGSAPNIADALADTSLNEPWKASQLNYEFPNRW
LIRKEQSDFGWDWGPAFAPAGVWQPAYIVQLSNNHLYVRNTLLDIYRQGQLNNLPPDQTK
PWVVNASLDVLGTIPQHAELRIEIKDASNKTVTSSVAKNVTISGGAISGSIVVEDSAVKL
WWPNGLGQQNLYFATVTVVNSGDTVVSSTKRTAFRTIVLNMEPISKRQLGQGIKNGNNWH
FEINGHEFYAKGSNFIPPDAFWPRVTTTKIQQLFDSVTKGNQNMLRVWASGAYQPDFIYD
IADEKGILLWSEFEFSDSLYPVAQSFLDNVREEAIYNVRRVNHHPSLALWAGGNELENLE
LYLAELYDPGNYSRWQKEYETLFLNVLLPAVYENSRSISYIPSSTTNGYLSLNHSAPHPM
VERYNNETEGYIYGDTDHYDYDSTVAFNLSSYPVGRFANEFGFHSMPSLQSWEEAVAPED
LHFNSTTIQLRNHHYPSGSLNTTNFANSTKGMGEMTIAVELYYPTPDKADPLANFSSWCL
ATQIFQADFYRSQIAYYRRGSGMPERQLGSLYWQLEDIWQAPTWAGIEYSGRWKMLHYIA
KDIYSPVIVAPYWNYTTGDLTAYVTSDLWESVNGTVDLTWYDWSGNVLSNVTNGTSSIPF
TVGALNTTKVLQTNTESLGKSVDLSNAVLKMNLTTTGHLPNDKTLSIFTHEFFYHPILSL
GKARLVDPGLNLIVNGNNDTTSGPTFTVRATSGVSAWTWLDSPSGVVGNFDGNGFWLVPG
ETKTVGFDVKNDTTGGEWVKNVTVSSLWDFSTP

Enzyme Prediction     

EC	3.2.1.25:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	39	799	3.4e-73	0.6662234042553191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	3.06e-42	24	731	12	636	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407625	Ig_mannosidase	3.90e-19	847	929	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
407658	Mannosidase_ig	1.48e-11	738	832	1	86	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	2.69e-07	244	335	22	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16350.1|GH2	0.0	19	929	19	927
BCS04781.1|GH2	0.0	19	929	19	927
QMW39414.1|GH2	0.0	18	929	17	926
QMW27343.1|GH2	0.0	18	929	17	926
CAK96951.1|GH2|3.2.1.25	0.0	19	929	19	926

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CVU_A	0.0	3	933	9	942	Structure of Fungal beta-mannosidase from Glycoside Hydrolase Family 2 of Trichoderma harzianum [Trichoderma harzianum],4UOJ_A Chain A, BETA-MANNOSIDASE GH2 [Trichoderma harzianum],4UOJ_B Chain B, BETA-MANNOSIDASE GH2 [Trichoderma harzianum]
6DDT_A	1.29e-116	32	929	18	866	mouse beta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]
2VJX_A	3.52e-85	27	768	10	694	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.65e-85	27	768	12	696	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.72e-85	27	768	12	696	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WMS9|MANBA_ASPFU	0.0	15	929	15	921	Beta-mannosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndA PE=3 SV=1
sp|B8NP78|MANBA_ASPFN	0.0	18	929	17	909	Beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndA PE=3 SV=1
sp|Q0CI48|MANBA_ASPTN	0.0	27	932	28	930	Beta-mannosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndA PE=3 SV=2
sp|Q2UN00|MANBA_ASPOR	0.0	18	929	17	909	Beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndA PE=3 SV=1
sp|A1CTM5|MANBA_ASPCL	0.0	22	929	22	927	Beta-mannosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999779	CS pos: 21-22. Pr: 0.9714

TMHMM  Annotations     

There is no transmembrane helices in PV06_04604-t43_1-p1.