CAZyme Information: PV06_04064-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_04064-t43_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
895		101737.59	6.1770

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847334.1:3734403-3737842(+)

Full Sequence      

MATETAPPPRERKPSMGAPISTFTGPVGPGFSRPKHKRTATGFGASDIKAVESSIPEHMR
EAWRKFSPKGFTSKEDFEAECVRHIETTLARSLFNCDELAAYSGTALAFRDRLIIDWNKT
QQRQTFADQKRIYYLSLEFLMGRALDNAMLNVGLKNVAKQGLDELGFRIEDIINQEHDAA
LGNGGLGRLAACFLDSMASLNYPAWGYGLRYRYGIFKQEIENGYQVEIPDYWLDFNPWEF
PRHDVTVDVQFFGWVNKYTDDEGKQVVSWQDGEMVTAVAYDVPVPGYGTSTVNNLRLWSS
KASSGEFDFAKFNSGDYESAVADQQRAETISAVLYPNDNLERGKELRLKQQYFWCAASLH
DIIRRFKKTQRKWSEFPDQVAIQLNDTHPTLAIVELQRILIDKEGLEWNAAWDIVTKTFG
YTNHTVLPEALEKWSVPLIQNLLPRHLQIIYDINLFFLQTVERRFPKDREMLSRVSIIEE
SNPKMVRMAYLAIVGSHKVNGVAELHSDLIKTTIFKDFVKVYGPDKFTNVTNGITPRRWL
HQANPRLSELIASKLGSYEFLKDLTLLNKLEPFVDDKEFKKEWAEIKYANKVRLAQHILK
SNGVSVNPKALFDVQVKRIHEYKRQQLNIFGVIHRYLAIKSMTPEERKKLAPRVSIFGGK
AAPGYWMAKTIIHLINKVGEVINKDPDVGDLLKVIFLEDYNVSKAEIIIPASDISEHIST
AGTEASGTSNMKFVLNGGLVIGTLDGANIEITREIGEENVFLFGNLAEDVEDLRHNHFYG
DYSVNPELLKVFECIKSGTFGDEAAFGALISAIVDHGDYYLVSDDFDSYCKTHDLIDESY
KNQDKWVSKSIQSVARMGFFTSDRCINEYADSIWNIEPLAVKEEAEVRARTGLEK

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	162	877	2e-285	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184948	PRK14986	0.0	105	879	45	813	glycogen phosphorylase; Provisional
223136	GlgP	0.0	73	878	5	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	123	874	52	794	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	83	876	3	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
340853	GT35_Glycogen_Phosphorylase	0.0	74	876	1	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK45551.1|GT35	0.0	8	882	6	880
APA13713.1|GT35	0.0	6	884	2	881
BCS09645.1|GT35	0.0	1	882	1	880
QMW43077.1|GT35	0.0	10	883	6	879
QRD89946.1|GT35	0.0	10	883	6	879

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	0.0	34	879	1	878	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
4BQE_A	3.03e-281	98	881	85	873	Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQE_B Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQF_A Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQF_B Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQI_A ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana],4BQI_B ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana]
1XOI_A	3.51e-270	60	882	7	833	Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens],1XOI_B Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens]
1FC0_A	3.51e-270	60	882	7	833	HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]
1EM6_A	3.63e-270	60	882	8	834	Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-526, 423 [Homo sapiens],1EM6_B Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-526, 423 [Homo sapiens],1EXV_A Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-403, 700 [Homo sapiens],1EXV_B Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-403, 700 [Homo sapiens],1L5Q_A Human liver glycogen phosphorylase a complexed with caffeine, N-Acetyl-beta-D-glucopyranosylamine, and CP-403700 [Homo sapiens],1L5Q_B Human liver glycogen phosphorylase a complexed with caffeine, N-Acetyl-beta-D-glucopyranosylamine, and CP-403700 [Homo sapiens],1L5R_A Human liver glycogen phosphorylase a complexed with riboflavin, N-Acetyl-beta-D-Glucopyranosylamine and CP-403,700 [Homo sapiens],1L5R_B Human liver glycogen phosphorylase a complexed with riboflavin, N-Acetyl-beta-D-Glucopyranosylamine and CP-403,700 [Homo sapiens],1L5S_A Human liver glycogen phosphorylase complexed with uric acid, N-Acetyl-beta-D-glucopyranosylamine, and CP-403,700 [Homo sapiens],1L5S_B Human liver glycogen phosphorylase complexed with uric acid, N-Acetyl-beta-D-glucopyranosylamine, and CP-403,700 [Homo sapiens],1L7X_A Human liver glycogen phosphorylase b complexed with caffeine, N-acetyl-beta-D-glucopyranosylamine, and CP-403,700 [Homo sapiens],1L7X_B Human liver glycogen phosphorylase b complexed with caffeine, N-acetyl-beta-D-glucopyranosylamine, and CP-403,700 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06738|PHSG_YEAST	0.0	34	879	24	901	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|Q00766|PHS1_DICDI	4.76e-318	64	882	23	846	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P34114|PHS2_DICDI	2.95e-295	74	877	111	908	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|Q9SD76|PHS2_ARATH	5.06e-281	98	881	52	840	Alpha-glucan phosphorylase 2, cytosolic OS=Arabidopsis thaliana OX=3702 GN=PHS2 PE=1 SV=1
sp|P32811|PHSH_SOLTU	7.38e-280	76	876	25	832	Alpha-glucan phosphorylase, H isozyme OS=Solanum tuberosum OX=4113 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV06_04064-t43_1-p1.