CAZyme Information: PV06_03679-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_03679-t43_1-p1
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614	KN847334.1|CGC15	71359.74	6.8718

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847334.1:2528212-2530208(+)

Full Sequence      

MHEYLRASNRSHVQGMLRSRRSLVLICLLATIAFTTFLLRRPQVILEESAAFSLLHGHHA
HEENQPLLPATSLLHPVHQLVARAEGDFQTVRARQSRSLSDAVAEYRRRYKLPPPPHFDK
WYDFAKKRGVELIDEYDTIYHQLLPFWALEPHVIRERTREAIGFDNALIAVMIRNGQVTK
IEGGGDMYAWHREATPIMLKEFIKWLPDMDLPFNIHDEPRVVMQHDDLLHHVQVAKDQNM
PKAYTAQTLSNSWSPRPGDLGEGVRIKEYKTTRFNRFAHQPTWSDSRLSCSPDSPARVCL
NDSCPDNTTAYSGVPLGFISNTTAFSDICNSPSMERTFGFFDRPNAFDVTHELFPIFSQS
KISSFQDILYPSPWYYMGRVTYEKDRDMPWEEKKATMYWRGSTTGGFSRDGGWRRQHRQR
FLTKIQPLNKAKILELDNSSATETVWREKEISAADVAQYFDVKFTYIGQCDPGDCDAQRE
YFGTVEPVNMFDALASKYLLDIDGNAFSGRYYAWLLSKSLVYKLAVFREWHDEWLRPWVH
YVPLGLAGDEYAESVRYFDQEVIGRVEGKRIAEGGRDWAQKVLRNDDLEVWYFRLLLEYG
RLIDDNRYNIGFSL

Enzyme Prediction     

No EC number prediction in PV06_03679-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	331	603	2.8e-78	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.94e-22	351	602	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	5.01e-12	355	602	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13289.1|GT90	1.56e-256	17	612	1	588
UCK57446.1|GT90	8.45e-249	74	614	84	619
BAE54850.1|GT90	3.40e-248	74	614	74	609
BCR83603.1|GT90	1.89e-245	75	614	66	600
CCD51306.1|GT90	4.01e-242	17	613	48	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	5.64e-09	332	606	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.49e-07	355	603	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.25e-42	68	609	146	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	6.63e-10	352	603	160	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	4.83e-09	332	603	138	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	3.36e-08	332	606	123	373	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q8NBL1|PGLT1_HUMAN	3.36e-08	332	606	123	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999911	0.000115

TMHMM  Annotations     

Start	End
21	38