CAZyme Information: PV06_03079-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_03079-t43_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499		53987.85	9.6713

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847334.1:688344-690086(-)

Full Sequence      

MAPPVMTTGSILLRYGCSHPIATLSALFLAWKSLLLLIIFTSPRLGYDTSSSLLLSVGGK
NENENAITGYLSGTPNQIESPWLKFVRWDAIYFTQMAEHGHVFEQEWAFGIGISSTIRWT
AKIIGRTMDIGNLTASFMVAGVCLSHVAHWLAVLQIWAIASHLMGAGGGGSNRKSQKESS
SEVPFLAAVMHIISPAGVFLSTPNTESLFACLSFCGFLAFLSATSQFHQGTVLRGACTMV
ASGLAFGLATLIRSNGILAGIPFLIEAVSIAFAVLSSQGVSLSRVVRLGSVVVGGLLVAT
GMVLPQVLAYQEYCAGQSPGQRREWCEWTIPSIFTFVQSHYWNVGPFRYWTFSNLPLFLL
AAPTLWILVQSAIEVMKKPEMVIRGKSPSSSSSSSPTGKGVTNTSTSKISSTNNNQHRLV
VAASLALPQFSLAVLAFTSYHVQIITRISSGYPLWYIWLAAKIRSQETKNTSVAIIIIRW
MIIYALVQAGLYASFLPPA

Enzyme Prediction     

No EC number prediction in PV06_03079-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	27	499	6.8e-106	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.31e-39	21	499	1	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	2.56e-10	187	378	151	322	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR82784.1|GT76	2.18e-103	19	499	19	465
QSS49377.1|GT76	1.24e-102	19	499	22	477
CAP97902.1|GT76	5.43e-100	19	499	22	450
CCT64606.1|GT76	2.97e-96	18	499	8	427
QUC16407.1|GT76	1.66e-95	18	499	7	427

PDB Hits     

PV06_03079-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I0K3|GPI18_GIBZE	1.81e-93	18	499	8	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	5.91e-88	18	499	16	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	6.86e-85	19	499	28	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.05e-81	18	499	16	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	4.56e-41	23	499	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000014

TMHMM  Annotations     

Start	End
20	42
137	159
206	223
230	252
256	275
288	310
347	369
418	440
444	461
473	495