CAZyme Information: PV06_02663-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_02663-t43_1-p1
• CAZy Family: GT91
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		53897.25	7.6879

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847333.1:3599575-3600972(-)

Full Sequence      

MVRLTPLRSLCVSLVICLLLTFPLISKILDRQRGYDLLDPQFKSDRQPLSDDVPYGIKCS
PFAAGVMDKVTIVLKMGAGEVSTRLPAYLNRLGRCGQDILLFSDRQHRYDALEIHDALAN
LDPKYRHDNPDFEMYDQYNDDASQQQRVHDNDGKEKSRKGWRLDKYKFLPMMEFTRHLRP
KSHWFVFIELDTYVNWDNMHRFLVRFDPATPYYFGSPVWPHKKPIFAHGGTGFVLSSAAL
DKLVAHGSKFVGRSKKDRSSYLPGTHLFGKDMQHECCGDEVLAGVLKESGVTLRGYWPMF
NGEKPTTARFGREQWCEAILTLHHLDTEDFLELQRWEQTTTSSRRDRSKPLTFEELFFGL
VEPLIRDRREDWTNMSEDVVYDEDDKNRAGKSYEACLKACTANERCIQFEHFGHTCRLSY
DIRLGHRQLPNGGKRWTSGWLMERIHDFKASHSPCNGAHIVHANP

Enzyme Prediction     

No EC number prediction in PV06_02663-t43_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	1.50e-07	173	274	76	197	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX99402.1|GT31	1.65e-182	1	465	3	448
CAE7208234.1|GT31	6.35e-175	1	465	2	448
QRC91512.1|GT31	2.10e-168	1	465	2	448
CCD43072.1|GT31	3.91e-78	54	465	55	457
ATZ46428.1|GT31	3.91e-78	54	465	55	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q4I_A	5.15e-06	166	259	91	179	Chain A, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster],7Q4I_B Chain B, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NS00|C1GLT_HUMAN	7.76e-07	177	244	157	224	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1
sp|Q0VC84|C1GLT_BOVIN	3.26e-06	177	244	157	224	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1
sp|Q9JJ05|C1GLT_RAT	4.26e-06	177	244	157	224	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1
sp|Q9JJ06|C1GLT_MOUSE	5.66e-06	177	244	157	224	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1
sp|Q5F3G7|C1GLT_CHICK	5.71e-06	177	244	158	225	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Gallus gallus OX=9031 GN=C1GALT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.952085	0.047941

TMHMM  Annotations     

Start	End
7	26