CAZyme Information: PV06_02604-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_02604-t43_1-p1
• CAZy Family: AA7
• CAZyme Description: extracellular protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289	KN847333.1|CGC10	32134.35	4.8557

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847333.1:3423884-3424753(-)

Full Sequence      

MILLTLLNLLLGVVFCTALPQRTSLAPSLVARSICSPRPKGLWQPVVGVSWNYQLLKPVA
SPSTIASKPKVWDIDLFDNNATSISTMKSNGHRVICYFSAGSYENWRPDASKFSPSDLGN
DLDGWPGEKWLNISSPKVRTIMKARLDLAVHKGCDGVDPDNVDGYDNDNGLDLTQDDSID
YMIFLANEAHGRNLSIGLKNAGAIIDDVVECMEWSVNEQCVQYTECDTYAVFIQHQKPVF
HVEYPKGPDTSNNNPVSSKTKKKYCTDPDEAHFSTILKNIDLDTWIETC

Enzyme Prediction     

EC	3.2.1.109:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	51	244	1.3e-77	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	8.06e-111	50	283	1	220	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	4.65e-32	56	204	67	219	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	3.75e-08	51	265	27	275	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS06525.1|GH114	3.33e-118	43	289	79	322
BCR93911.1|GH114	3.33e-118	43	289	79	322
CAK44466.1|GH114	1.31e-115	43	289	80	323
EAW09378.1|GH114	1.57e-112	43	289	83	326
QMW37588.1|GH114	7.36e-112	43	289	77	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	5.24e-110	43	289	34	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	9.33e-110	43	289	51	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

PV06_02604-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000378	0.999574	CS pos: 18-19. Pr: 0.9240

TMHMM  Annotations     

There is no transmembrane helices in PV06_02604-t43_1-p1.