CAZyme Information: PV06_02070-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_02070-t43_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617	KN847333.1|CGC18	67253.87	5.9897

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847333.1:1716426-1718466(-)

Full Sequence      

MAGSVCTADEFVRHTYDYLICGGGTAGLVLAARLSEQSDITVGVIEAGKNTLDDPNVLTP
LLFPTLISNPDYDWMYTTSPQHGCHHQVHSMPRGKGLGGSSSINFMVYVRGHKSDYDDWA
AFDAPEWAFSKLLPCFKKSEQLEAPANEEDARSVSSQYHGTTGPIHTSFNDWGLRIDNEI
LEAFKSTSGRSTRPLDPWSGDHVGFFTSLSVIDRKQNKGTRSYAGSAYLAPSMERANLKV
LCETTVSKIILDNNVAVGVKVLHKGQEHSVRTRREVIASCGVIGSPQLLELSGIGDPAIL
RAAGVECLVPNPAVGTNFQDHIISAVGLELKKGDFSLDSLPTSPDFEAFQKQYMTTREGP
LAYAPGTMGFLPLQALVEDAELEEMIRQIERTKTNTEFHKKQLTQVIEQLKSPTSANVQY
LVIPTQMKFEEGTSDQSKLYGKFHAEDNDRVALAVCLQYPASRGTVHITTSDPQRYPQID
PGYLSHPADVKALAASVKFAGKAIDSLVDNGKIARRVSPDVNNGLEDESLQRFVRENCIG
EYHGMGTCAISEVVDGHLRVKGVKGLRVVDASVFPNNISANLLASVYAVAERAAELIKED
GYQGAFAKLGPDVHAHL

Enzyme Prediction     

No EC number prediction in PV06_02070-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	15	600	2.8e-167	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.07e-115	14	598	4	532	choline dehydrogenase; Validated
225186	BetA	8.37e-111	15	600	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	8.28e-63	17	597	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.01e-36	460	593	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.76e-31	91	321	21	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29957.1|AA3_2	2.55e-190	4	600	10	610
BCS21673.1|AA3_2	6.96e-185	2	600	10	614
UKZ78676.1|AA3_2	3.64e-184	5	610	14	625
UJO21990.1|AA3_2	1.60e-180	4	600	11	613
SMQ52591.1|AA3_2	1.03e-179	8	604	29	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.37e-75	16	600	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.51e-74	16	600	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	2.34e-68	16	597	41	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5HSA_A	3.63e-62	12	604	3	640	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
4YNT_A	6.48e-62	15	600	5	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	2.61e-155	7	600	5	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	2.14e-154	10	600	8	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.14e-154	10	600	8	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.43e-81	7	600	31	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	1.72e-77	14	597	5	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000008

TMHMM  Annotations     

There is no transmembrane helices in PV06_02070-t43_1-p1.