CAZyme Information: PV06_02047-t43_2-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_02047-t43_2-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593		66127.66	7.2415

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847333.1:1642290-1644179(-)

Full Sequence      

MLGGTAGCVVAARLAEADPNLRVLLIEQGQNNYERPEVVYPALFPGNILTDSKTALFWKG
NKSVQLADREPIVPSGGILGGGSSINWMVYTRASKSDLTSWATPGWSADDLYPFLKKFET
YHGRGEREHHGYDGPINVSSGTFRAKRAENEFIDAAAKLGYPEFKDLQNLDANNGTERWL
RYVGPDGKRQDAAHRYIHPKLQSGQYPNLHVLVQHQVVRVLFNENKRAGGVVIQANPKFE
DASRTARRVVRATKMVVLSTGANATPLILERSGIGQAEYVKRAGVPMIEELAGVGNDYQD
HHLTLYAYRTSLSPRETINAFADGRFNVQEMIKNKDELLGWNSMDASGKFRPTDAEVEAL
GPDFKRAWERDFKKFSDKPLMIIAMYLSFFGDHSTLPGDAEYVSMANWTAYPYSRGHIHV
SGPDLTDPIDFDVGYLKDVNEIDVKKHIWAYKTQREIFRRMGIFRGELASSHPKFPSGSE
AQVVEKTDGPMAVDDNKRIQYSAEDDKAIEQHVRETVSTTWHSLGTCKMAPREKKGVVDA
SLSVYGTKGLKLADLSIVPENVGANTNNTAFLVGEKAADIFIRELELKDKPRL

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	585	2.1e-266	0.9813559322033898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.42e-58	3	579	15	531	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.16e-52	3	583	13	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.49e-33	412	577	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.93e-26	86	301	34	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.95e-08	187	574	218	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO18841.1|AA3_3	1.05e-295	3	593	7	604
UJO12159.1|AA3_3	8.79e-295	3	588	23	592
QDS68623.1|AA3_3	4.43e-293	3	592	21	608
SMY20971.1|AA3_3	1.58e-291	3	591	20	615
SMR45817.1|AA3_3	6.39e-291	3	591	20	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6H3G_A	1.04e-141	3	590	14	629	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	4.13e-141	3	590	14	629	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5HSA_A	2.26e-134	3	585	14	636	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6YS2_AAA	2.43e-43	3	578	15	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	8.49e-43	3	578	15	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00922|ALOX_CANBO	1.72e-142	3	585	14	636	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|P04841|ALOX_PICAN	6.13e-137	3	585	14	637	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|C4R702|ALOX2_KOMPG	2.08e-134	3	585	14	636	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1
sp|F2R038|ALOX2_KOMPC	2.08e-134	3	585	14	636	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|F2QY27|ALOX1_KOMPC	1.16e-133	3	585	14	636	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.910145	0.089903

TMHMM  Annotations     

There is no transmembrane helices in PV06_02047-t43_2-p1.