CAZyme Information: PV06_02047-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_02047-t43_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611		68005.73	6.7183

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847333.1:1642290-1644290(-)

Full Sequence      

MGLYTELPGDLYDVDVIVAGGGTAGCVVAARLAEADPNLRVLLIEQGQNNYERPEVVYPA
LFPGNILTDSKTALFWKGNKSVQLADREPIVPSGGILGGGSSINWMVYTRASKSDLTSWA
TPGWSADDLYPFLKKFETYHGRGEREHHGYDGPINVSSGTFRAKRAENEFIDAAAKLGYP
EFKDLQNLDANNGTERWLRYVGPDGKRQDAAHRYIHPKLQSGQYPNLHVLVQHQVVRVLF
NENKRAGGVVIQANPKFEDASRTARRVVRATKMVVLSTGANATPLILERSGIGQAEYVKR
AGVPMIEELAGVGNDYQDHHLTLYAYRTSLSPRETINAFADGRFNVQEMIKNKDELLGWN
SMDASGKFRPTDAEVEALGPDFKRAWERDFKKFSDKPLMIIAMYLSFFGDHSTLPGDAEY
VSMANWTAYPYSRGHIHVSGPDLTDPIDFDVGYLKDVNEIDVKKHIWAYKTQREIFRRMG
IFRGELASSHPKFPSGSEAQVVEKTDGPMAVDDNKRIQYSAEDDKAIEQHVRETVSTTWH
SLGTCKMAPREKKGVVDASLSVYGTKGLKLADLSIVPENVGANTNNTAFLVGEKAADIFI
RELELKDKPRL

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	603	1.2e-271	0.9949152542372881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.06e-61	13	597	7	531	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.35e-55	15	601	7	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.30e-33	430	595	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.13e-26	104	319	34	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.39e-10	15	592	57	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS68623.1|AA3_3	6.08e-305	1	610	1	608
UJO12159.1|AA3_3	3.58e-301	1	606	1	592
SMY20971.1|AA3_3	2.61e-297	1	609	1	615
SMR45817.1|AA3_3	1.06e-296	1	609	1	615
UJO18841.1|AA3_3	1.48e-295	21	611	7	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6H3G_A	3.00e-146	13	608	6	629	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	1.19e-145	13	608	6	629	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5HSA_A	1.46e-137	13	603	6	636	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6YS2_AAA	1.51e-45	5	596	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	5.30e-45	5	596	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00922|ALOX_CANBO	2.79e-146	13	603	6	636	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|P04841|ALOX_PICAN	1.41e-140	13	603	6	637	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|C4R702|ALOX2_KOMPG	1.35e-137	13	603	6	636	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1
sp|F2R038|ALOX2_KOMPC	1.35e-137	13	603	6	636	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|F2QY27|ALOX1_KOMPC	7.53e-137	13	603	6	636	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000034

TMHMM  Annotations     

There is no transmembrane helices in PV06_02047-t43_1-p1.