CAZyme Information: PV06_01459-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_01459-t43_1-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		41958.96	4.2954

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847332.1:4286949-4288254(+)

Full Sequence      

MKSSLLAILGGASSALAAVRGFNYASQGQDYNGFASQFKTAASLAGASDFTSARLYTMIQ
EGTTNTPIDAIQAAIDTNTTLLLGLWASVDQSTFDNEITALKSAIQQYGSSFADLVVGIS
VGSEDLYRISPTGIAAGSGVGQSPDTLVNYIGQVRDTIKGTSLGTKPVGHVDTWNVFVND
TNSKVISNCDFLGLDEYPYYQTTDTNSIDNSSFLFFQAYDRVSAVAQGKPIWVTESGWPT
TGPTSNLAVASVDDAETFWQGVACALENRGINFWWYILADEGASPSFGVSSNGKPLYNLA
CNSTAGYTSTSSASSSTATASKNGTATASHGSGSGSGSATLSTVTASGAAGAGPSGAVPA
GATGSSGAGAGGATATQNGGATGTNGATHSTFTGAATKAQGSMAGLAIGALFAALVL

Enzyme Prediction     

No EC number prediction in PV06_01459-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	28	301	1.9e-17	0.9807073954983923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.65e-27	19	292	45	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.95e-12	121	301	108	309	Glycosyl hydrolases family 17.
381626	GH113_mannanase-like	0.004	190	295	181	301	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC96667.1|GH17	7.88e-105	2	301	4	316
CAE7194820.1|GH17	2.77e-104	1	301	3	316
QIX00265.1|GH17	4.28e-102	3	301	4	309
QKX54194.1|GH17	4.83e-102	13	310	14	320
CBX90501.1|GH17	6.06e-101	13	305	15	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	7.58e-22	81	295	94	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	4.93e-21	81	295	94	290	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG16|EGLC_ASPFU	3.47e-95	17	305	18	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	3.91e-95	17	305	18	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	3.10e-94	3	305	4	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	1.27e-93	5	304	6	313	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q5AUT0|EGLC_EMENI	3.35e-91	2	305	4	315	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.304158	0.695830	CS pos: 17-18. Pr: 0.6775

TMHMM  Annotations     

There is no transmembrane helices in PV06_01459-t43_1-p1.