CAZyme Information: PV06_01146-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_01146-t43_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
902		102112.32	5.4820

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847332.1:3367156-3369914(+)

Full Sequence      

MSPATLHPGPRRPKPIQVPTLDTIHQLDDNDDEDVAPDVIPDAAQRVASTTSSKVNGGEL
PPNYVKFEVMLLYLRQQQLEKRWAIENNTTEGVILRRGKDDYICRPLELPKHVNGFYDEA
TKLNVKVAMTVRTTVIQTFLSSYKHQYVPFNNGQRLRIIDSISELSFSKRHYYAAFVRGQ
GLLVVWDEDPTLLFDRAEHIQRYIVNMLWTAEDLAGEGDDEDDIEDEKTMIGLAPKQAET
ASGNYVIDPESKAGEVWEKPRKIVLYQSILVGLVAILTIFCLAIGWRRIAIEITIDHSYV
RLAILIAAPLEAWLGWFFFMTLVNGVSQIIGPVAQLTKNSKFYSSRPPVRLTKKDLPHVT
IQCPVYKEGLEAVIHPTMVSINKAISTYELQGGSANILINDDGLQLISEEHARRRLQYYE
DNNIGWIARPPHQPKGDENGENVYVRAGKFKKASNMNYCLDVSVRIEDKMAQTIRTPTWT
QEDENLLYQHCFDEVIKEDQGRTWGNGDIRVGDYILLIDSDTRVPEDCLLDAVSEMEASP
EVAIIQYSSGVLNVTTSFFERAITFFTNLVYTAIRFAVANGDVAAFVGHNAILRWSAVQD
VRYSDAVTGSEKYWAENTVSEDFDMALRLQGRGYILRFGTYCGDKFKEGVSLTVYDELAR
WEKYAYGCAELVFQPFRYWFVRGPFTPMFRRFMCSPMSLMGKITIMAYVGTYFAIASAWP
LTVMNYFLIGWLNGYIDQAYVNSFNIYFGIVVVFQALGTVSLAVLRYRTENRSLLGSLIE
NLANLLLLTVYLGGLSLHVSQAILSYLFSIDMTWGATAKEAENTSFFREIPVILKKFKFT
FCFCLVSTTTMIVMAGVGPVGALVPYDWRITTFTAIFPLAILTVNHFLLPLALNPGLMQF
TF

Enzyme Prediction     

No EC number prediction in PV06_01146-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	514	723	9.2e-49	0.9695431472081218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	5.04e-47	514	729	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	4.35e-14	512	779	138	387	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	4.76e-11	512	622	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
225494	MdoH	1.30e-08	502	826	235	556	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
133034	Glucan_BSP_MdoH	2.14e-07	502	594	90	179	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
USW53192.1|GT0	0.0	63	901	69	887
SMY19115.1|GT0	0.0	58	902	61	883
SMQ45410.1|GT0	0.0	58	902	61	883
UJO15800.1|GT0	0.0	65	902	72	888
SMR43958.1|GT0	8.89e-317	58	902	61	900

PDB Hits     

PV06_01146-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

PV06_01146-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000001

TMHMM  Annotations     

Start	End
263	285
298	320
708	730
743	765
785	807
843	865
875	897