CAZyme Information: PV06_01028-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_01028-t43_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613	KN847332.1|CGC6	67504.04	6.0662

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847332.1:2969795-2971766(+)

Full Sequence      

MPPPVEEEFDFIVVGAGNAGAVVAGNLARSKAKPRVLLIELGGDNSAAHLRIPSERFINP
YVNPNIVLDYKTTPQKHLNGRVLDYLRGTGLGGSSIANFLAYIRGTASDYNRWADLVDDD
SWRWENVLERYNELENLHFSGGNDDADSDPEGYVKLKPGAHGFDGPVDLTLPSRKEWPEG
LDILMQAAKSHGLPLNPDQNSGDIIGMAGVTTTTHAGWRVTSASAYLTNPPSNLVLWTNS
AVTQVVFDTNTTSTKQQPRASGVILSDGRQVRATKEVILSLGTIDTPKLLMLSGIGDRTE
LEKHGISCLVNSPRVGKDLIDHVYLVMTYGAKSTLGTKVAFQQNKEYVKAAREQWLRNQT
GPDATLNTINIIGFLKFDSRRINFDEMYKLDSKTRNFLERPDVPQYEFYMQGYIPDDWDV
EKHGPECLGMAVMLMNPQSRGYVALASKDPLARPIIETNYLAHPYDRQTINNAVKEAMSF
AKSKQLSPYLLDKVLGPESDSDEHVTKFVKDELMSILHGVGTVMMGPKHEDTSSSSFSPC
DTDFRVRGVDGLRVIDLSVCPTITNNHTQATAYLVGHMGWKKLCDEYNLESPSGHASGSS
SSGGSGLSREHRL

Enzyme Prediction     

No EC number prediction in PV06_01028-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	578	1.2e-144	0.9823943661971831

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.98e-87	6	576	3	524	choline dehydrogenase; Validated
225186	BetA	1.71e-79	2	576	1	526	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.84e-33	437	578	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	7.15e-30	6	583	53	577	Protein HOTHEAD
366272	GMC_oxred_N	1.87e-25	79	322	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS73506.1|AA3_2	4.26e-126	7	587	3	563
QSS48722.1|AA3_2	8.48e-126	7	587	3	563
ATZ54666.1|AA3_2	5.51e-118	1	592	1	575
QDS74375.1|AA3_2	1.78e-116	3	589	2	568
CAE7200393.1|AA3_2	4.10e-116	6	591	3	570

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	3.51e-70	8	579	1	557	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.59e-70	8	579	2	558	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	8.00e-63	4	588	36	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3NNE_A	5.81e-44	6	576	11	519	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
2JBV_A	5.81e-44	6	576	11	519	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|V5NDL4|PDH1_AGACM	5.03e-65	4	588	32	595	Pyranose dehydrogenase OS=Agaricus campestris OX=56157 GN=pdh1 PE=1 SV=1
sp|Q3L243|PDH2_LEUMG	5.57e-65	4	588	36	600	Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris OX=201219 GN=pdh2 PE=2 SV=1
sp|Q3L245|PDH1_LEUMG	4.12e-62	4	588	36	602	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	2.82e-61	4	573	36	585	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q3L1D1|PDH1_AGABI	4.76e-60	4	573	36	579	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV06_01028-t43_1-p1.