CAZyme Information: PV06_00992-t43_2-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_00992-t43_2-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751	KN847332.1|CGC12	84043.48	9.0170

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847332.1:2864096-2866598(+)

Full Sequence      

MAVSTALDPFLRGSMSKNTRGLLRIIILLTIAGAAVSARLFSVIRFESIIHEFDPWFNFR
ATKYLVANGFYKFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGVIYHLLRLLSIPVDIRNI
CVLLAPGFSGFTALAMYLLTSEMSSSPSAGLLAAAFMGISPGYISRSVAGSYDNEAIAIF
LLVFTFFLWIKAVKNGSIMWGALAALFYGYMVSAWGGYVFITNLIPLHAFTLILMGRYSS
RLYISYTTWYALGTLASMQVPFVGFLPIRSSDHMAALGIFGLLQLVAFFNFLRDQLPGKQ
FQTLLVALGGAIFGIMFVGLIALTLSGTIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQP
TAWPAFFFDLNMLIWLFPAGVYMCFRNLKDEHVFVVLYAVLASYFAGVMVRLMLTLTPVV
CCAAALAISHILDTYLYIPSPVDESNEPSNGSVKGSKISANPSLRSIRNPLIGIYSLASK
SLITSMFTGFLLLFVAHCTWVTSNAYSSPSVVLASRLPDGSQHIIDDYREAYYWLRQNTP
KDAKIMSWWDYGYQIGGMADRPTLVDNNTWNNTHIATVGKAMSSREEVSYPILRQHDVDY
VLVVFGGLLGYSGDDINKFLWMVRIAEGIWPEEVRERDFFTARGEYRVDDEATPTMRNSL
MYKMSYYNYNQLFPAGQAQDRVRGSPLPAQGPELSTLEEAFTSENWIIRIYKVKDLDNVG
RDHQSAVAFDKGHKKKRKAGSKKGVRVLRED

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	24	671	6.6e-194	0.84992784992785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	8.52e-145	32	507	11	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	6.59e-110	32	721	28	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	2.22e-28	52	562	32	547	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX54042.1|GT66	0.0	4	749	3	740
UDD65301.1|GT66	0.0	5	749	4	740
QGA20009.1|GT66	0.0	4	749	3	739
QMW36082.1|GT66	0.0	5	749	4	740
QRD92953.1|GT66	0.0	5	749	4	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	0.0	22	721	15	690	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	2.30e-292	34	718	83	777	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	7.16e-271	10	720	6	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	1.44e-270	10	720	6	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	3.94e-268	10	715	6	696	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	0.0	14	749	15	751	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	0.0	22	721	15	690	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|E2RG47|STT3B_CANLF	4.15e-292	34	718	83	777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q3TDQ1|STT3B_MOUSE	1.07e-291	34	718	80	774	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2
sp|Q8TCJ2|STT3B_HUMAN	1.18e-291	34	718	83	777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000002

TMHMM  Annotations     

Start	End
21	43
91	113
120	139
149	170
177	199
214	236
243	265
275	292
304	326
363	385
392	414