CAZyme Information: PV06_00635-t43_2-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_00635-t43_2-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein, variant 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		68957.80	7.0763

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847332.1:1804588-1806665(-)

Full Sequence      

MDGGNGSKVSRLPAHVTVNEFVQRQYDYIICGGGTAGLTIAARLTEDPNVTVGVIEAGSN
HLGNPLVDTPAALLEMLNNPEYDWSFRTTPQAGNKNKVHHVPRGKLLGGSSGINYMMYVR
GSDEDYDGWAKLVNDPSWSSSNMKHYMRKHQTIEPVDERVTADRTCMPCVAENHGTSGPI
HTSFNDFRLPIEDDVIQAAEQAAGVTKKPTDPWSGDHMGFYNTLGTVTRRTGPDKGRRSY
AAGGYFRPNAQRPNLKLITESLVCRVLLDNTNTVARGVEFRDKSGARHTVVATREVIVTG
GAINSPQILELSGIGDPKILRAAGVECLVPLPSVGTNYQDHVGSAVTYQLTPGNMSGDAM
FIPEVMAAAQKQLVEEQGGPLTAVQSVQGYFPASTVLEPGELDEIIRSIESAEPATDFQK
KQWAQVAAHVKDSRSANLQLIFLNATVNLADGAGDQSKLMAPPPPADPGTAAPNGMSLGV
SLQYPVSRGHVHIKSSDPTRHPEVNPNYLAHPADVAVLAAGLKFVETMARRSPGLRGKLG
RRIGPPPQVVPSLDTAGERRAAVREFCMGEYHSCGTCAMGDTVDQRLRVRGVRNLRVADA
SIFPNNVSGNICATVYAVAEKAADMIKEDGKNDNNGSLKAKL

Enzyme Prediction     

No EC number prediction in PV06_00635-t43_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	25	629	3.8e-170	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.26e-114	23	627	3	532	choline dehydrogenase; Validated
225186	BetA	2.25e-104	24	629	6	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	6.22e-57	27	626	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	5.28e-40	485	622	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.65e-32	101	341	21	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO22487.1|AA3_2	1.82e-227	12	627	12	617
SMR58876.1|AA3_2	2.41e-225	21	629	11	609
SMQ54443.1|AA3_2	4.84e-225	21	629	11	609
SMY28092.1|AA3_2	6.85e-225	21	629	11	609
SMR62716.1|AA3_2	9.71e-225	21	629	11	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.79e-69	26	629	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	9.55e-69	26	629	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	5.60e-67	26	632	6	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	6.63e-65	22	629	2	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5ZU3_A	3.77e-56	26	632	7	575	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	1.13e-163	15	629	3	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	2.34e-163	14	629	2	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.34e-163	14	629	2	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	9.17e-86	24	626	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	9.17e-86	24	626	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000012

TMHMM  Annotations     

There is no transmembrane helices in PV06_00635-t43_2-p1.