CAZyme Information: PV06_00503-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_00503-t43_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851		92593.16	5.6891

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847332.1:1456104-1458726(-)

Full Sequence      

MANDDAGDNGADFWHTAALERFNVPKVRFSDGPNGIRGTRFFGGVSAACIPCGTALGATW
DRDLLFDAGKLLGSECIAKGAHCWLGPTINIQRSPLGGRGFESYSEDPHLSGTLAASIVR
GCESTGVQASPKHFVANDQEHERRAVDTLITPRALREVYLRPFQIVARDARPGVLMTSYN
KINGVHVAHDPRFITGIVREEWKWDPLVVSDWHGTFSTTEAVNAGLDLEMPGPPKMRGRL
GDFVQSSRLIKQSVLDERARRVLAFVKRATTDVPRVAVTGAEPQTEGQQGVVRNTPLDRA
LNRDLCRKSIVVLKNDSGLLPLPSTAKTKKVAVLGSHMKLPVVSGGGSAVLQPYYTVTPW
EALSARYAAAGVEVTHEVGMPAYKMLPILDKLIRRPDDNDEDDGNNRPGGGVMYFYNSPP
STPDRVCVAVERFQTAYCQLMDYKHPGLNFDLFYITAKTVFTPDESGEWDFGLSVYGTAD
VYVGGELVIDESGRREERQGAGGAFFGKGTPERRGTKTLEGGKGYEVTVEFASSATSTSP
QVGVTTFGGGGFRLGAAPHVESREASIGRACDVAREADYAVLCTGLSEEWECEGADRVGF
CLPPGIDDLVARVLAAQPNTVVVTQSGTPFAAPWEPRAGTLVHAWYGGNETGNGVADVLF
GDFCPSGKLPLSWPREIRDNPAFLNWGSTGGRVLYGEDVFVGYKFYDELERLPVFSFGHG
LSYTTFVIAPDTTTTSSAVSRDWVSVTVTNTGKVTGTETVQVYVHAKTSQVRRPKRELQG
FTKVVDLAPGESRTVQVKIDQYAAALWDEAEEKWMYEKGEYEVLVGNSSRVEDLVSAGSF
HVEKTTWWLGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	18	231	1.5e-59	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.31e-65	51	833	121	759	beta-glucosidase BglX.
224389	BglX	1.23e-59	3	354	39	383	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.63e-43	557	703	71	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	5.62e-34	37	263	78	314	Glycosyl hydrolase family 3 N terminal domain.
405066	Fn3-like	7.38e-26	758	829	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP92979.1|GH3	5.52e-317	9	851	24	828
BCS24030.1|GH3	1.38e-312	10	851	25	830
UDD60961.1|GH3	7.08e-312	10	851	23	827
BAE61738.1|GH3	8.17e-312	10	851	37	841
QMW31983.1|GH3	9.06e-312	10	851	30	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.84e-216	9	851	23	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.63e-213	9	851	23	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.14e-111	9	845	22	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.16e-100	9	830	22	653	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.46e-80	19	829	87	817	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XM94|BGLH_ASPFC	0.0	9	851	24	829	Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglH PE=3 SV=1
sp|Q4WL79|BGLH_ASPFU	0.0	9	851	24	829	Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglH PE=3 SV=1
sp|A1DPG0|BGLH_NEOFI	0.0	9	851	24	829	Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglH PE=3 SV=1
sp|Q5B6C7|BGLH_EMENI	4.16e-317	9	851	24	831	Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglH PE=3 SV=2
sp|Q2U9M7|BGLH_ASPOR	8.87e-313	10	851	23	827	Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglH PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000014

TMHMM  Annotations     

There is no transmembrane helices in PV06_00503-t43_1-p1.