CAZyme Information: PV06_00291-t43_1-p1

Basic Information

• Species: Exophiala oligosperma
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala oligosperma
• CAZyme ID: PV06_00291-t43_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	KN847332.1|CGC17	41218.87	7.0723

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EoligospermaCBS72588	11938	N/A	45	11893

• Gene Location: location=KN847332.1:820130-821283(+)

Full Sequence      

MTISPNTRRLAAIVVVLVILCLFLRSTSSSTADSALIHPTAQAADQPSRSYPPPKAGQKT
TSDESTLRILASKPLRERLRYHFPYDVETKFPAYVWQTWKEGPGSGKFEARLRPFEASWT
TLHPGFVHEVVTDDAAVHLINYLYASTPDVVEAYEAMPLPVLKADFFRYLILLARGGIYS
DIDTSAIKSATEWLPESLDKSQVGLVVGIEADPDRPDWNEWYARRIQFCQWTIQSKPGHP
VLRDIVASITEDTLAMKKAGHLRAGQTPHKSIMEYTGPGVWTDTLFSYFNNRDFFDFSTR
RSNITYSDFFALKEHKKIGDVIVLPITSFSPGVGQMGAEGADHPMAFVKHEFDGSWKPAE
ERMKRT

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	117	196	5.8e-20	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.80e-42	69	357	59	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.99e-20	118	197	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA11100.1|GT32	1.48e-151	53	362	49	356
QRC95216.1|GT32	1.83e-150	40	362	61	376
ATZ52760.1|GT32	5.62e-150	54	362	65	372
CCD51914.1|GT32	5.62e-150	54	362	65	372
BCS07268.1|GT32	1.10e-148	55	357	55	357

PDB Hits     

PV06_00291-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.40e-96	46	357	70	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	4.17e-81	81	357	132	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	4.10e-77	75	357	80	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	5.13e-76	75	357	114	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.546390	0.453612

TMHMM  Annotations     

There is no transmembrane helices in PV06_00291-t43_1-p1.