CAZyme Information: PUG3_T013861-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T013861-RA-p1
• CAZy Family: GT60
• CAZyme Description: Glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249		27768.08	7.1268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC4699:18-764(-)

Full Sequence      

AKSPTTIRSNLANHHATFITETEIAAIAAAGLNTVRVPVGYWITGFDNNDPSGKGEWKAF
TKGTLKYLDLLIKQWAKKHNIAVLISIHAAKGSQNGADHSSPANKGKAYWSDYSENVQNT
ISMATFLADRYKDEAAFLGIGLLNEPNGSTNENVLYQYYQDAYKAIRDAGNDCVLSVAPL
LWKQNPDTMTNFMQAPAYKNVWVEWHPYFVWGYEQTSEADLINVAVKTNFQGDVTKWNSR
ANHNQLFIG

Enzyme Prediction     

No EC number prediction in PUG3_T013861-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	11	237	3.9e-42	0.776173285198556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.13e-18	3	172	58	217	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.14e-08	31	249	37	234	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29069.1|GH5	3.06e-124	1	249	98	346
UIZ29004.1|GH5	6.09e-121	1	249	89	337
CCA17636.1|GH5	4.40e-84	14	249	199	431
UIZ29723.1|GH5	2.69e-78	14	237	65	286
AAM18484.1|GH5	5.83e-76	14	237	73	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3N9K_A	2.37e-23	11	238	66	287	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
3O6A_A	4.49e-23	11	238	66	287	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	5.91e-23	11	238	61	282	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
1EQP_A	5.91e-23	11	238	61	282	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
4M80_A	6.19e-23	11	238	66	287	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	1.77e-24	9	217	83	279	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|O93983|EXG2_WICAO	4.65e-24	8	238	89	309	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	3.35e-22	9	175	73	230	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|P29717|EXG1_CANAL	4.31e-22	11	238	105	326	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q8NKF9|EXG_CANOL	5.40e-22	6	228	84	299	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T013861-RA-p1.