CAZyme Information: PUG3_T013836-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T013836-RA-p1
• CAZy Family: GT60
• CAZyme Description: Exoglucanase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264		28655.21	7.4207

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC4597:4-795(-)

Full Sequence      

MQDDSNYKLYKLLNQEFSFDVDVSKLPCGLNGALYFVQMDADGGKSKYPSNKAGAAYGTG
YCDAQCPHDVKFINGEANVLNWTPSATDPNAGNGKYGSCCMEMDIWESNSISSAYTPHPC
TVESQTRCTSDTQCGFGSGNRYKGVCDRDGCDNNPYRMGNTTFFGPGSSFKIDTTKPFTV
ITQFITSDKTANGNLVEIKRLFKQNGKVIENPKINIAGIDPINSITDKVCSQSKVAFKDP
DDHKAKGGLAQMGKALKKGVVLTM

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	1	264	1.1e-116	0.6

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395677	Glyco_hydro_7	1.07e-176	3	264	113	369	Glycosyl hydrolase family 7.
153432	GH7_CBH_EG	3.98e-132	1	264	104	337	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD79798.1|GH7	3.64e-127	1	264	129	388
UIZ25851.1|GH7	4.70e-127	7	264	143	398
BAA76365.1|CBM1|GH7	1.38e-122	1	264	126	385
UIZ21725.1|GH7	3.47e-120	7	264	143	403
BAD16575.1|CBM1|GH7	2.49e-119	1	264	125	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XSP_A	2.61e-119	3	264	115	372	Structure of Cellobiohydrolase 1 (Cel7A) from Heterobasidion annosum [Heterobasidion annosum],2YG1_A APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum],2YG1_B APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum]
1Q9H_A	1.10e-117	1	264	108	368	Chain A, cellobiohydrolase I catalytic domain [Rasamsonia emersonii],3PFJ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFX_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFZ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PL3_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii]
4XNN_A	2.63e-115	5	264	120	379	Chain A, Cellobiohydrolase CHBI [Daphnia pulex],4XNN_B Chain B, Cellobiohydrolase CHBI [Daphnia pulex],5MCC_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 1.11 MGy [Daphnia pulex],5MCC_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 1.11 MGy [Daphnia pulex],5MCD_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 3.27 MGy [Daphnia pulex],5MCD_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 3.27 MGy [Daphnia pulex],5MCE_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 5.43 MGy [Daphnia pulex],5MCE_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 5.43 MGy [Daphnia pulex],5MCF_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 7.59 MGy [Daphnia pulex],5MCF_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 7.59 MGy [Daphnia pulex],5MCH_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 9.75 MGy [Daphnia pulex],5MCH_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 9.75 MGy [Daphnia pulex],5MCI_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 11.9 MGy [Daphnia pulex],5MCI_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 11.9 MGy [Daphnia pulex],5MCJ_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 14.1 MGy [Daphnia pulex],5MCJ_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 14.1 MGy [Daphnia pulex],5MCK_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 16.2 MGy [Daphnia pulex],5MCK_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 16.2 MGy [Daphnia pulex],5MCL_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 18.4 MGy [Daphnia pulex],5MCL_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 18.4 MGy [Daphnia pulex],5MCM_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 20.6 MGy [Daphnia pulex],5MCM_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 20.6 MGy [Daphnia pulex],5MCN_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 22.7 MGy [Daphnia pulex],5MCN_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 22.7 MGy [Daphnia pulex]
1GPI_A	5.52e-114	1	264	108	361	Chain A, EXOGLUCANASE I [Phanerodontia chrysosporium],1H46_X Chain X, EXOGLUCANASE I [Phanerodontia chrysosporium],1Z3T_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3V_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3W_A Chain A, cellulase [Phanerodontia chrysosporium]
4V1Z_A	5.91e-113	1	264	111	371	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P13860|GUX1_PHACH	3.78e-112	1	264	126	379	Exoglucanase 1 OS=Phanerodontia chrysosporium OX=2822231 GN=CBH1 PE=2 SV=1
sp|Q06886|GUX1_PENJA	1.98e-111	1	264	134	394	Exoglucanase 1 OS=Penicillium janthinellum OX=5079 GN=cbh1 PE=2 SV=1
sp|A1DNL0|CBHB_NEOFI	4.57e-111	1	264	137	397	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=cbhB PE=3 SV=1
sp|B0Y8K2|CBHB_ASPFC	4.84e-111	1	264	137	397	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=cbhB PE=3 SV=1
sp|Q4WM08|CBHB_ASPFU	4.84e-111	1	264	137	397	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T013836-RA-p1.