CAZyme Information: PUG3_T012948-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T012948-RA-p1
• CAZy Family: GT48
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265		29775.45	5.4968

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC2792:825-2191(-)

Full Sequence      

FGYGSGVHAPGYTGYEYVVGHHVLLSHAAVVQRFRELKKHDVIRKKARISIVLSADHTYP
LDPSNPLDVAAADRKSDFILGWFLLPIVTGHYPATMRERIGNRLPEFTTEEAELLKGSYD
LFMLNYYSSRAGTDCSTEQSTVPCGEGNSQWARDLGVDDNRLPDGSLLPTFSPDAGISYC
KLFTPHPAGYLDTIKWMHAKDPKADILLTENGHCGDETIEDAGQLSYFQTHVEQVHKAIY
EFQIPIIGYTAWSFLDNYEWAQIEK

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	262	9.2e-51	0.5128205128205128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	1.35e-58	1	261	172	415	Glycosyl hydrolase family 1.
225343	BglB	8.70e-31	1	261	175	417	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	1.71e-23	2	259	195	444	beta-glucosidase
215435	PLN02814	6.36e-21	17	259	221	444	beta-glucosidase
215539	PLN02998	5.46e-14	17	259	227	449	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29641.1|GH1	5.49e-97	2	265	185	450
EGZ16993.1|GH1	1.63e-95	2	265	204	469
CCA20215.1|GH1	1.38e-86	2	264	195	458
UIZ29273.1|GH1	2.06e-69	17	252	148	369
UJO16644.1|GH1	8.90e-42	2	262	179	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4GXP_A	1.65e-39	2	262	181	429	Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_B Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_C Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8]
4MDO_A	2.59e-39	2	262	197	460	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	4.38e-39	2	261	174	426	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	4.38e-39	2	261	174	426	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	5.75e-39	2	261	193	445	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O64883|BGL26_ARATH	6.96e-37	3	260	205	458	Beta-glucosidase 26, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=BGLU26 PE=1 SV=1
sp|Q9FLU9|BGL31_ARATH	1.89e-35	17	260	237	475	Beta-glucosidase 31 OS=Arabidopsis thaliana OX=3702 GN=BGLU31 PE=2 SV=1
sp|Q9FLU8|BGL32_ARATH	3.61e-35	17	260	237	475	Beta-glucosidase 32 OS=Arabidopsis thaliana OX=3702 GN=BGLU32 PE=2 SV=2
sp|Q9SPP9|RG1_RAUSE	3.65e-34	17	262	240	479	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q25BW4|BGL1B_PHACH	9.58e-34	2	261	183	439	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T012948-RA-p1.