CAZyme Information: PUG3_T011977-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T011977-RA-p1
• CAZy Family: GT20
• CAZyme Description: Mannosyl-oligosaccharide alpha-1,2-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		44828.56	5.7995

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC1922:36-1593(+)

Full Sequence      

MFEEFDEASGWIAMNLETRMHYDGWVSVFETTIRVMGGLLSSFYLSGHEHLLVAAKKLGD
LLTPAFKEYEHGFPDKDYNIMAQAPSLAEVGSLQLEFKYLARLTGKNEYRDQVERIMNSL
ARDVAEKYPNGLLPVVVNQRTGRISGGKVTLGANGDSYYEYLLKQWLLSGKRETKYKNQY
IVAVNGIMDQLVAKSKPSGLVFIGELVDGHLSPKMDHLVCFVPGMLALGYMHGMPESHLK
LAEQLLETCYQMYAQMNAKLAPEIAYFNMNDDASKDLDIHPRDAFNLLRPETVESLMIMY
RVTKNEKYRVYGREIMRAFEKHCRLETGGYMSIGNVAKGPVQTKFRDGMESFFIAETLKY
LFLLFSDDSVFSLDQIVFNTEAHPFPMEQPVLAD

Enzyme Prediction     

EC	3.2.1.113:99

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	3	386	2.1e-117	0.8811659192825112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	2.97e-158	3	386	51	452	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	8.50e-153	3	386	128	517	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27321.1|GH47	9.57e-185	1	389	200	608
AIG56487.1|GH47	2.81e-126	1	390	130	509
AWP06495.1|GH47	3.94e-117	3	387	252	641
CAB1321727.1|GH47	6.13e-117	3	387	247	636
BAG51987.1|GH47|3.2.1.113	3.82e-116	3	390	8	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FO2_A	8.36e-117	3	390	66	459	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KIJ_A	1.84e-116	3	387	61	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	2.23e-116	3	387	66	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
5KK7_A	4.06e-116	3	390	61	454	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	8.93e-116	3	390	144	537	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2GUY0|MA1B1_RAT	9.24e-114	3	390	263	656	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|A2AJ15|MA1B1_MOUSE	1.34e-113	3	390	264	657	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|Q9UKM7|MA1B1_HUMAN	3.92e-113	3	390	305	698	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|Q93Y37|MNS3_ARATH	1.10e-96	7	389	189	622	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
sp|Q8J0Q0|MNS1_CANAX	8.89e-87	3	386	96	507	Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans OX=5476 GN=MNS1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T011977-RA-p1.