CAZyme Information: PUG3_T011563-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T011563-RA-p1
• CAZy Family: GT110
• CAZyme Description: Glycogenin-1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245		27179.96	9.1347

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC1694:2972-3851(-)

Full Sequence      

MTVGVRRAAYTTLITSDAYAMGVEALVYSLFKARATFPLVVLHSSQVTQPTVAKLTRFCA
QFQSSTWHISFRSVPDIGIPDEVTDRSTVHVPGWVNSGYTKLHIFAMDDFEQIVYIDADV
IVLQNVDELFDRSTSFAAAPDVFPPDRFNAGVLVIRPNKQLFADLLVKAKELKSYDGGDT
GFLNAFFPKWFESDAASRLPTPGTGTPSSRSRFCTTRRIQSPGRIRVARVTWRSCGGKCT
RNPDA

Enzyme Prediction     

EC	2.4.1.186:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	7	191	6.4e-33	0.7626459143968871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	4.46e-56	9	190	2	170	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
132996	Glyco_transf_8	1.93e-15	9	193	2	203	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
215090	PLN00176	2.74e-13	1	191	17	227	galactinol synthase
227884	Gnt1	1.21e-12	7	196	59	261	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
133064	GT8_GNT1	5.29e-12	96	187	78	170	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19642.1|GT8	5.26e-68	9	200	3	193
CBZ55023.1|GT8	3.71e-33	7	200	4	274
AAI64360.1|GT8	9.55e-29	9	200	5	184
AAH68329.1|GT8	9.55e-29	9	200	5	184
AAH97080.1|GT8	9.55e-29	9	200	5	184

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	2.66e-136	1	200	1	200	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
3T7M_A	7.04e-29	9	200	6	185	Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form [Homo sapiens],3T7M_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form [Homo sapiens],3T7N_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a monoclinic closed form [Homo sapiens],3T7N_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a monoclinic closed form [Homo sapiens],3T7O_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP-Glucose and glucose [Homo sapiens],3T7O_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP-Glucose and glucose [Homo sapiens],3U2U_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltotetraose [Homo sapiens],3U2U_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltotetraose [Homo sapiens],3U2V_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltohexaose [Homo sapiens],3U2V_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltohexaose [Homo sapiens],3U2X_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and 1'-deoxyglucose [Homo sapiens],3U2X_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and 1'-deoxyglucose [Homo sapiens]
6EQJ_A	7.04e-29	9	200	6	185	Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant, apo form [Homo sapiens],6EQL_A Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant complexed with manganese and UDP [Homo sapiens],6EQL_B Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant complexed with manganese and UDP [Homo sapiens]
3Q4S_A	7.04e-29	9	200	6	185	Crystal Structure of Human Glycogenin-1 (GYG1), apo form [Homo sapiens],3QVB_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP [Homo sapiens],3U2W_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens],3U2W_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens]
3RMV_A	9.86e-29	9	200	6	185	Crystal Structure of Human Glycogenin-1 (GYG1) T83M mutant complexed with manganese and UDP [Homo sapiens],3RMW_A Crystal Structure of Human Glycogenin-1 (GYG1) T83M mutant complexed with manganese and UDP-glucose [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46976|GLYG_HUMAN	1.81e-27	9	200	5	184	Glycogenin-1 OS=Homo sapiens OX=9606 GN=GYG1 PE=1 SV=4
sp|H2KYQ5|GYG1_CAEEL	1.32e-26	9	200	4	183	Glycogenin-1 OS=Caenorhabditis elegans OX=6239 GN=gyg-1 PE=1 SV=1
sp|Q9R062|GLYG_MOUSE	1.94e-26	9	200	5	184	Glycogenin-1 OS=Mus musculus OX=10090 GN=Gyg1 PE=1 SV=3
sp|O08730|GLYG_RAT	2.70e-26	9	200	5	184	Glycogenin-1 OS=Rattus norvegicus OX=10116 GN=Gyg1 PE=2 SV=4
sp|O15488|GLYG2_HUMAN	8.35e-26	9	200	38	217	Glycogenin-2 OS=Homo sapiens OX=9606 GN=GYG2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T011563-RA-p1.