CAZyme Information: PUG3_T011477-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T011477-RA-p1
• CAZy Family: GT1
• CAZyme Description: Glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		42468.23	7.0911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC1649:4354-5541(-)

Full Sequence      

MVLGEGIPQQVSIWTNSFWSTLTGKPSGRELIDPQGVRAWKHGRQCIWIDEGVWGLNDKG
RAELFKPNYFSGVDFGTECYVPFASRYAKSIQSVLPIAMVFVEMPPIDFNASPFPEIEPD
VIPYAVNAMHWYDITTLLQCTWSESITIDFHTKWPVFSAAARRELHEKQLQHIHSFGKQK
MDNAPTLIGEVGIPFNLNGGKAYKNGDFSEQIAAMNHTMSCLEANLLSFTLWNYTADNSN
KYGDLWNLEDLSLVSHDTEQKRASSNAKVQDRNAAARALTAFCRPYATRVAGFPQKSVFT
MENSRHAIAVPTEIYVPRVQYPKGFKVKATGGKIEIHNQDGWDLVTFQHDPRATTHSLVV
LPKEEERRRSLLPWM

Enzyme Prediction     

No EC number prediction in PUG3_T011477-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	1	240	7.6e-55	0.5027829313543599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	3.55e-14	284	360	1	86	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27469.1|GH5_12	1.04e-122	1	370	287	685
CCA13966.1|GH5_12	1.89e-94	1	356	333	727
AIG56220.1|GH5_12	1.26e-92	1	360	299	657
BAJ64239.1|GH5_12	4.72e-70	1	336	266	600
QRN82755.1|GH5_12	2.66e-58	1	332	265	595

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	2.00e-29	1	339	303	748	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1BTD7|EGCR1_RHIO9	7.61e-41	3	321	288	628	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|P40566|EGH1_YEAST	7.40e-29	2	351	298	731	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
sp|H1AE13|EGCR1_ASPFM	9.94e-29	1	257	279	565	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	1.32e-28	3	375	292	690	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T011477-RA-p1.