CAZyme Information: PUG3_T011461-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T011461-RA-p1
• CAZy Family: GT1
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		42031.11	5.8231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC1641:2457-4012(+)

Full Sequence      

MSREVRFPDGFVWGASTAAYQIEGATNEGGRGDCMWDAFSRTPGKTLMKNMGLKHYRMSI
SWPRILPAGIGKVNEEGVDFYNRLINELLANGIEPLVTLYHWDLPLALHNPHTEPYIVSH
NLLLAHARAVEIYRNEFKEKQGGKIGITYSCDWREPAPTDDPEKAKQNIEASQRALEFAL
GWHADPVYFGDYPQSMKDRVGDRLPKFTKEEKKLLKGSSDFFGLNTYGTQYVEPSEEFIA
GQLPPNDATGGHIADQGVTLSSDPSWKRTDVGWNVVPWGIGKLLLWINNRYTPPGGIYIT
ENGCAWPSNSKEEAENDDFRVDYYRGYIEHVRKAITEGADVRGYYAWSFIDNYEWSQGYS
KRFGLHWVGL

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	112	368	2.3e-71	0.5104895104895105

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	3.14e-139	6	368	4	427	Glycosyl hydrolase family 1.
274539	BGL	1.04e-121	8	368	1	410	beta-galactosidase.
225343	BglB	3.22e-101	6	368	3	429	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	1.33e-84	7	368	28	458	beta-glucosidase
215455	PLN02849	1.80e-79	7	368	30	458	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23722.1|GH1	1.48e-189	1	368	1	448
AOW21694.1|GH1	4.05e-130	5	368	1	432
QYM78582.1|GH1	2.05e-129	6	368	3	438
UOB17187.1|GH1	3.28e-129	5	368	1	432
QOD61968.1|GH1	7.24e-129	6	368	3	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YJ7_A	4.21e-116	2	365	26	457	Chain A, Glycoside hydrolase [Nannochloris],5YJ7_B Chain B, Glycoside hydrolase [Nannochloris],5YJ7_C Chain C, Glycoside hydrolase [Nannochloris],5YJ7_D Chain D, Glycoside hydrolase [Nannochloris]
3GNO_A	5.33e-98	7	368	17	465	Crystal Structure of a Rice Os3BGlu6 Beta-Glucosidase [Oryza sativa Japonica Group],3GNP_A Crystal Structure of a Rice Os3BGlu6 Beta-Glucosidase with Octyl-Beta-D-Thio-Glucoside [Oryza sativa Japonica Group],3GNR_A Crystal Structure of a Rice Os3BGlu6 Beta-Glucosidase with covalently bound 2-deoxy-2-fluoroglucoside to the catalytic nucleophile E396 [Oryza sativa Japonica Group]
3WBA_A	5.49e-98	7	368	18	466	Rice Os3BGlu6 E178Q with Covalent Glucosyl Moiety from p-nitrophenyl glucopyranoside. [Oryza sativa Japonica Group]
3WBE_A	5.49e-98	7	368	18	466	Rice Os3BGlu6 Beta-Glucosidase E178Q mutant in a covalent complex with Glc from GA4GE. [Oryza sativa Japonica Group]
7F3A_A	1.63e-94	7	368	22	459	Chain A, Beta-glucosidase 42 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FZE0|BGL40_ARATH	9.13e-98	7	368	37	485	Beta-glucosidase 40 OS=Arabidopsis thaliana OX=3702 GN=BGLU40 PE=2 SV=1
sp|Q5N863|BGL04_ORYSJ	1.68e-97	7	368	15	450	Beta-glucosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU4 PE=2 SV=1
sp|Q8L7J2|BGL06_ORYSJ	6.97e-97	7	368	50	498	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q339X2|BGL34_ORYSJ	2.87e-96	7	368	38	486	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1
sp|Q9FIW4|BGL42_ARATH	8.14e-94	7	368	21	458	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999932	0.000101

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T011461-RA-p1.