CAZyme Information: PUG3_T011449-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T011449-RA-p1
• CAZy Family: GT1
• CAZyme Description: Pectin lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		36443.15	9.9035

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC1635:28-1038(+)

Full Sequence      

FDFRGSEGKKTETGCRPKSNRECIAKKNGHKGQDVILQSGGMANTGGCIEGTPVTITYDI
AATKNPLQVTDNKTLRGIGNAGVIIGKGLWINGNNVIIQNVHITNLNPHLIWGGDAIYIQ
GKNGGSTPMERVWIDHVKISLVGRQMMTTNTASVKSMTISNSDFDGRTSWSASCDGRHYW
TFIFHGTQTRISMIKNYVHSTSGRSPKFGGSTDPKTDVVAHAVNNYWADNSGFSFDVAEK
AFVLMEGNYFESTANPNLQDSTTTGSVFVPTSSNQNYCKLYLGRKCVGNVLQNSGKLVSR
QDSVAIARLKGLTGKYTPTDAKKLAIVTSNFGVGALK

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	55	251	2.8e-79	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	6.65e-28	53	253	1	189	Amb_all domain.
226384	PelB	1.67e-10	29	336	51	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	5.63e-09	64	250	27	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19255.1|PL1_4	7.63e-165	1	336	69	398
ACR19252.1|PL1_4	8.13e-165	1	336	103	432
ACR19247.1|PL1_4|4.2.2.10	1.25e-163	1	336	69	398
ACR19251.1|PL1_4	1.78e-163	1	336	69	398
ACR19249.1|PL1_4	7.40e-156	1	336	103	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	1.66e-55	1	336	49	359	Pectin Lyase A [Aspergillus niger]
1QCX_A	9.95e-54	1	313	49	337	Pectin Lyase B [Aspergillus niger]
1IDJ_A	1.64e-51	1	336	49	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	1.88e-82	1	336	69	380	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	3.61e-78	1	336	70	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	3.61e-78	1	336	70	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|B8N316|PELF_ASPFN	1.10e-77	1	336	69	382	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	1.10e-77	1	336	69	382	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000007

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T011449-RA-p1.