CAZyme Information: PUG3_T010812-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T010812-RA-p1
• CAZy Family: GH81
• CAZyme Description: Chitin synthase (Chitin-UDP-GlcNac-transferase)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625		71126.79	6.8382

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC1370:972-3053(+)

Full Sequence      

MNRRPRLMICITIYNEGPQQLKATLRKLVNNLTYLKNQQPGHEKTLSKTFAGEDVWQNVL
VCIIADGREQINEKMLDYLEAIGLYDEDLLTINSAGIGAQCHLFEHTLQLTNNNKSLMPI
QAIFALKEEKASKLDSHHWYFNAFAEQIQPEFTAVMDVGTMLTKSALYHLLYAFESNRQI
GGACGQLTVEDPFKNLSNWVISAQHFEYKISNILDKSLESCFGFISVLPGAFSAYRYEAI
RGEPLEAYFQTLNGCNWTMHYVKDAIARTDVPHDLVSLISQRKRWLNGSFFATLFSIWNW
GRVYSESTHTFTRKMFLLLFYVYHVAYTLFAFFLPANLYLALFFIVFQGFQQNRLVFIDT
SSYSQNVLDGAVYLFNLVYLFGLLMLIIIGLGNNPKHMKLTYYMVGATFGAIMMLSSLVG
LGVFFSSPVTTSSVVVSILTIGVYFIGSAIHGEMHHIFLTFTHYTALIPSFVNIFTIYSF
CNLQDLSWGTKGLNADPLLTPGEDSEKGDFKDRYFEAFRTNILLLWAFANLIFALIIVYF
SDSGSYMPALYVTVAVINASRLIGCIGHWMYIHTESLRAQFIDKSRSGNGNAYSENSFRQ
LEDHYNQLTEDHRIYSSNKSGASMV

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	13	174	4.7e-51	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.60e-57	14	174	2	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	1.25e-53	9	292	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	2.98e-21	141	346	129	341	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.11e-17	123	241	56	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
367353	Chitin_synth_2	1.65e-14	151	287	203	372	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC77245.1|GT2	0.0	3	624	228	903
ARC77248.1|GT2	0.0	3	624	228	903
ARC77247.1|GT2	0.0	3	624	228	903
ARC77246.1|GT2	0.0	3	624	228	903
AGT99185.1|GT2	0.0	3	624	228	903

PDB Hits     

PUG3_T010812-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J9VGT6|CHS8_CRYNH	5.18e-94	3	564	370	1019	Chitin synthase 8 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS8 PE=3 SV=2
sp|P48017|CHS_SAPMO	1.22e-93	1	495	237	739	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|Q99127|CHS4_USTMA	2.42e-89	3	564	281	929	Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS4 PE=3 SV=2
sp|J9VMX7|CHS7_CRYNH	2.81e-89	2	509	202	773	Chitin synthase 7 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS7 PE=2 SV=2
sp|P87073|CHS1_PHYB8	5.95e-88	1	537	162	792	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

Start	End
325	347
367	389
404	426
433	450
460	482
521	540
550	572