CAZyme Information: PUG3_T010727-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T010727-RA-p1
• CAZy Family: GH81
• CAZyme Description: Cell 5A endo-1,4-betaglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611		67431.57	5.2619

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC1341:1879-4196(+)

Full Sequence      

MSSDARLSVIKGRATDIKLVATEPSEGTPTERQRDYKGRYRRWPGVVFCLALFGIATALI
VFGAIKAKDSATKNQQRYEYTTQEARKIQDGLNNTEDIIEDDGQIGNPKVYPNMSCELPN
YLSKNGQIIAQSANGTEVAVAIKGVNWFGMETGVRIPLGLWENSDNGTSAYEIAAFLARN
KFNSVRLPVCIKSILDNVAPSSDLINLNTNRALNISTYMSTIQTIVKALAGIRVPMGLWE
NSDNGTSVYEIASFLARNKFNSVRLPVCIKSILDDIPPNKNLINMNTNRAMNISTYMSTI
QSIVKALAYRHVTVMISLHTLDTKVSGGAWYSTELDVTEAQFLKAVDVLTTNLCGPDYWN
ILGLDLKNEPHICSWGGAAPDWAKGAKLIGNQMLKGCKNWMAFVEGTNAAHSFTLNGTTI
SYYDWWGSGLQGVAKVPVELSMEEKVVYAPHYYNTGVNPASYLYGGGTIGSANVLNNYIE
LDDDHLKYNVEATFDDMFGYIAKNKKEAVVLGEFAGLYATDKHPKLTTKRTTDFTIQAML
DSGLAGGYMWSLNPESAYQYNPADTYGTFTEGLLEDDWLTPNKVFLEGMAQMNALPDLKM
FPCFQVEEATS

Enzyme Prediction     

No EC number prediction in PUG3_T010727-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	233	556	6.1e-134	0.9447674418604651

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.99e-14	191	561	3	371	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.27e-09	237	521	17	243	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABC87087.1|GH5_20	4.30e-246	13	611	65	587
ABK59035.1|GH5_20	4.30e-246	13	611	65	587
ABC87086.1|GH5_20	2.32e-241	13	607	58	575
ABL75350.1|GH5_20	1.95e-240	13	607	59	576
ABG80550.1|GH5_20	2.11e-237	2	611	49	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VVG_A	6.65e-28	260	580	65	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	6.65e-28	260	580	65	363	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	1.96e-27	260	580	98	396	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	2.64e-27	260	580	98	396	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	8.67e-27	260	580	98	396	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19487|GUNA_XANCP	2.04e-23	260	578	79	354	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P23548|GUN_PAEPO	2.76e-23	237	583	73	372	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P10474|GUNB_CALSA	1.39e-15	239	468	652	906	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999937	0.000082

TMHMM  Annotations     

Start	End
43	65