CAZyme Information: PUG3_T010181-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T010181-RA-p1
• CAZy Family: GH7
• CAZyme Description: Methyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1348		152087.15	6.3886

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC1176:1641-5859(-)

Full Sequence      

MMQLLARQRPLAARRHALLLLLLCELLPGGWGWDSAQTGGVKTPSLGTHQAERQYVPTAP
VNLVVNNADHDEMGRTDAEEALFKEAMRVYAQVSATAVVITAQATKLGSTNLAFQYFHEA
FDIATNLNGALPLDQEYWLHFQYAELLRQSIASNAIFEQRLVNELKRQAIHHYECALSTD
YRMNERVKYVSNTTNLVASNRIHVLNTIGMLLMDLHDVRASIPFFEHAVAADPTAVQPLG
NLALALMNLGETEAALHINKQALELDPNQSYVLHNAGNILHLLGREDEAIVYWERAYHIN
PNEPEILNGIATHYGLRGNMNKALQFLQRASILTEATLAANPSQLEAIAAYNRAQLRLAS
SRLPLVYQSADEIVEARFQYASSLQSLLSESKAPLILPEPITTVSMGSMGYYAVYQGFND
VGIRSQLAQVYKKGITALSFTAPHVVQGRNKTYQFMFPPSATTRMNRKARRIAKRFAKYS
NDTVHVHRRIRVGFHSGYMRYHSVGLLMQGVITHLPRDAFEVIVIIYDDNQRDELTELVL
NSADNVVFLSHQLHEARLQIADLELDVLVFTEIGMDLQTYFLAFSRLALRTAMFWGHXXX
XXXXXVTSGIDTVDYFVSSKLFYDAQAESLSANSHTGANEQQSKYTECVFEMGHLTTYFL
PPLIPQEQATPTSDTLLRESLGLPSKDVLPVMILIPQTLYKFHPDFDRLIERVLSSGSEI
SFLAVPIGAMSWLGDDIRRRWRRTLSPSVYRRIYFLRPLSTADFLGVCAMADLVLDPFPV
GGGRSSFEIFAVGTPIVMLATRTTILQLTAAMYNVMGITDLITYFEDDFVEITVRLARDK
GFRTHFRQRILENKHKLFENAVVIREWETFLISILAAKPPPERTSNEAEENARMTTECPH
VLPSAPVKEPFFEVVVYVNVLGGVNSEGTKVASTITMPSREDDPFEISEEFAERFHPPLD
SLKQNVVAKIMWNAKHRQSQSVVRTVNFSIDGSTSLPVEIRYGDDLHFAFEIHLKKQPKL
TLDAASRDAAMNELKRLAPEHTSPAWIAARSFPFRPSETQTSSGNELRDCVTLLITTCKR
LSLFLRTITSLQHALRIKQESDWSNWFCHVLIVDDNSSPADRDTMKAHLPTTVEFFFKTP
DQRGHAKSLNLAIERIQSQFVLYLEDDWEFQNISKDDREHAPPLSFLSDALAILRSSRDS
EKDEPLALVLLNHQNSGWERRLDSPGSNNHSVRYFVHEFAVCDPAHTFSYWPGFSLNPGV
WDLRAIFQALDNGLEHHPSKPIFDENSDIFERDASIRIWRSGLRVAYLSEDTVVHIGAPP
GTNASAYVLNGMPRTWDLPSVAPILVEP

Enzyme Prediction     

No EC number prediction in PUG3_T010181-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	260	874	1.8e-56	0.5631205673758866

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	7.45e-32	242	869	73	609	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	1.06e-18	239	330	4	95	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	8.21e-18	204	297	3	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
223533	TPR	1.07e-12	72	330	64	290	Tetratricopeptide (TPR) repeat [General function prediction only].
276809	TPR	2.76e-10	270	363	1	85	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAP54338.1|GT41	3.19e-58	355	873	138	584
BAZ61948.1|GT41	7.12e-56	363	877	448	887
BAZ15802.1|GT41	7.12e-56	363	877	448	887
QDT18528.1|GT41	3.02e-53	360	886	485	933
QGQ23490.1|GT41	5.25e-53	355	875	479	922

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	1.02e-07	487	850	160	489	Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]

Swiss-Prot Hits     

PUG3_T010181-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001146	0.998793	CS pos: 32-33. Pr: 0.9619

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T010181-RA-p1.